Rabbit SCARB2 Polyclonal Antibody | anti-SCARB2 antibody

SCARB2 antibody - N-terminal region

Cat. Num. AAA3215303

• Gene Names: SCARB2; AMRF; EPM4; LGP85; CD36L2; HLGP85; LIMP-2; LIMPII; SR-BII
• Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rat
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: SCARB2; Polyclonal Antibody; SCARB2 antibody - N-terminal region; anti-SCARB2 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Horse, Human, Mouse, Pig, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: VARVFQKAVDQSIEKKIVLRNGTEAFDSWEKPPLPVYTQFYFFNVTNPEE
• Sequence Length: 478

• Applicable Applications for anti-SCARB2 antibody: Western Blot (WB)
• Homology: Cow: 86%; Dog: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Pig: 86%; Rat: 79%
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SCARB2 AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)

Related Product Information for anti-SCARB2 antibody

This is a rabbit polyclonal antibody against SCARB2. It was validated on Western Blot

Target Description: The protein encoded by this gene is a type III glycoprotein that is located primarily in limiting membranes of lysosomes and endosomes. Earlier studies in mice and rat suggested that this protein may participate in membrane transportation and the reorganization of endosomal/lysosomal compartment. The protein deficiency in mice was reported to impair cell membrane transport processes and cause pelvic junction obstruction, deafness, and peripheral neuropathy. Further studies in human showed that this protein is a ubiquitously expressed protein and that it is involved in the pathogenesis of HFMD (hand, foot, and mouth disease) caused by enterovirus-71 and possibly by coxsackievirus A16. Mutations in this gene caused an autosomal recessive progressive myoclonic epilepsy-4 (EPM4), also known as action myoclonus-renal failure syndrome (AMRF).

Product Categories/Family for anti-SCARB2 antibody

Polyclonal; Mitochondria; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 5031631
• NCBI GeneID: 950
• NCBI Accession #: NP_005497
• NCBI GenBank Nucleotide #: NM_005506
• UniProt Accession #: Q14108
• Molecular Weight: 53kDa
• NCBI Official Full Name: lysosome membrane protein 2 isoform 1
• NCBI Official Synonym Full Names: scavenger receptor class B member 2
• NCBI Official Symbol: SCARB2
• NCBI Official Synonym Symbols: AMRF; EPM4; LGP85; CD36L2; HLGP85; LIMP-2; LIMPII; SR-BII
• NCBI Protein Information: lysosome membrane protein 2
• UniProt Protein Name: Lysosome membrane protein 2
• Protein Family: Lysosome membrane protein
• UniProt Gene Name: SCARB2
• UniProt Synonym Gene Names: CD36L2; LIMP2; LIMPII; LGP85; LIMP II
• UniProt Entry Name: SCRB2_HUMAN

NCBI Description

The protein encoded by this gene is a type III glycoprotein that is located primarily in limiting membranes of lysosomes and endosomes. Earlier studies in mice and rat suggested that this protein may participate in membrane transportation and the reorganization of endosomal/lysosomal compartment. The protein deficiency in mice was reported to impair cell membrane transport processes and cause pelvic junction obstruction, deafness, and peripheral neuropathy. Further studies in human showed that this protein is a ubiquitously expressed protein and that it is involved in the pathogenesis of HFMD (hand, foot, and mouth disease) caused by enterovirus-71 and possibly by coxsackievirus A16. Mutations in this gene caused an autosomal recessive progressive myoclonic epilepsy-4 (EPM4), also known as action myoclonus-renal failure syndrome (AMRF). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Feb 2011]

Uniprot Description

SCARB2: Acts as a lysosomal receptor for glucosylceramidase (GBA) targeting. Defects in SCARB2 are the cause of progressive myoclonic epilepsy type 4 with or without renal failure (EPM4). An autosomal recessive progressive myoclonic epilepsy associated with renal failure in some cases. Cognitive function is preserved. Myoclonus is a brief, involuntary twitching of a muscle or a group of muscles. Cognitive function is preserved. Genetic variants in SCARB2 can act as modifier of the phenotypic expression and severity of Gaucher disease. Belongs to the CD36 family.

Protein type: Receptor, misc.; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 4q21.1

Cellular Component: lysosomal lumen; focal adhesion; membrane; lysosomal membrane; integral to membrane

Molecular Function: protein binding; enzyme binding; receptor activity

Biological Process: protein targeting to lysosome; cell adhesion

Disease: Epilepsy, Progressive Myoclonic 4, With Or Without Renal Failure