Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Lanes:Lane 1: 40ug mouse brain extract Lane 2: 40ug mouse brain extract Lane 3: 40ug mouse brain extract Lane 4: 40ug mouse brain extractPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRP Anti-rabbit-HRPSecondary Antibody Dilution:1:8000Gene Name:VPS26ASubmitted by:Wen-Cheng Xiong, Georgia Health Sciences University)

Rabbit VPS26A Polyclonal Antibody | anti-VPS26A antibody

VPS26A antibody - C-terminal region

Gene Names
VPS26A; HB58; PEP8A; VPS26; Hbeta58
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
VPS26A; Polyclonal Antibody; VPS26A antibody - C-terminal region; anti-VPS26A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM
Sequence Length
327
Applicable Applications for anti-VPS26A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Lanes:Lane 1: 40ug mouse brain extract Lane 2: 40ug mouse brain extract Lane 3: 40ug mouse brain extract Lane 4: 40ug mouse brain extractPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRP Anti-rabbit-HRPSecondary Antibody Dilution:1:8000Gene Name:VPS26ASubmitted by:Wen-Cheng Xiong, Georgia Health Sciences University)

Western Blot (WB) (Lanes:Lane 1: 40ug mouse brain extract Lane 2: 40ug mouse brain extract Lane 3: 40ug mouse brain extract Lane 4: 40ug mouse brain extractPrimary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit-HRP Anti-rabbit-HRPSecondary Antibody Dilution:1:8000Gene Name:VPS26ASubmitted by:Wen-Cheng Xiong, Georgia Health Sciences University)

Western Blot (WB)

(WB Suggested Anti-VPS26A AntibodyTitration: 0.5 ug/mlPositive Control: Fetal kidney)

Western Blot (WB) (WB Suggested Anti-VPS26A AntibodyTitration: 0.5 ug/mlPositive Control: Fetal kidney)
Related Product Information for anti-VPS26A antibody
This is a rabbit polyclonal antibody against VPS26A. It was validated on Western Blot

Target Description: This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. The close structural similarity between the yeast and human proteins that make up this complex suggests a similarity in function. Expression studies in yeast and mammalian cells indicate that this protein interacts directly with VPS35, which serves as the core of the retromer complex.
Product Categories/Family for anti-VPS26A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
vacuolar protein sorting-associated protein 26A isoform 1
NCBI Official Synonym Full Names
VPS26, retromer complex component A
NCBI Official Symbol
VPS26A
NCBI Official Synonym Symbols
HB58; PEP8A; VPS26; Hbeta58
NCBI Protein Information
vacuolar protein sorting-associated protein 26A
UniProt Protein Name
Vacuolar protein sorting-associated protein 26A
UniProt Gene Name
VPS26A
UniProt Synonym Gene Names
VPS26; hVPS26
UniProt Entry Name
VP26A_HUMAN

NCBI Description

This gene belongs to a group of vacuolar protein sorting (VPS) genes. The encoded protein is a component of a large multimeric complex, termed the retromer complex, involved in retrograde transport of proteins from endosomes to the trans-Golgi network. The close structural similarity between the yeast and human proteins that make up this complex suggests a similarity in function. Expression studies in yeast and mammalian cells indicate that this protein interacts directly with VPS35, which serves as the core of the retromer complex. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

VPS26A: Essential component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. Also required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA). Belongs to the VPS26 family.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 10q21.1

Cellular Component: intracellular membrane-bound organelle; retromer complex; early endosome; endosome membrane; cytosol; endosome; vesicle

Molecular Function: protein binding; protein transporter activity

Biological Process: intracellular protein transport; retrograde transport, endosome to Golgi

Research Articles on VPS26A

Similar Products

Product Notes

The VPS26A vps26a (Catalog #AAA3215301) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VPS26A antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's VPS26A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the VPS26A vps26a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVDEEDRRYF KQQEIILWRK APEKLRKQRT NFHQRFESPE SQASAEQPEM. It is sometimes possible for the material contained within the vial of "VPS26A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.