Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CD83 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Thymus)

Rabbit anti-Human, Pig CD83 Polyclonal Antibody | anti-CD83 antibody

CD83 Antibody - C-terminal region

Gene Names
CD83; BL11; HB15
Reactivity
Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD83; Polyclonal Antibody; CD83 Antibody - C-terminal region; anti-CD83 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALV
Sequence Length
205
Applicable Applications for anti-CD83 antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CD83
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CD83 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Thymus)

Western Blot (WB) (WB Suggested Anti-CD83 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Thymus)
Related Product Information for anti-CD83 antibody
This is a rabbit polyclonal antibody against CD83. It was validated on Western Blot

Target Description: The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-CD83 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
CD83 antigen isoform a
NCBI Official Synonym Full Names
CD83 molecule
NCBI Official Symbol
CD83
NCBI Official Synonym Symbols
BL11; HB15
NCBI Protein Information
CD83 antigen
UniProt Protein Name
CD83 antigen
Protein Family
UniProt Gene Name
CD83
UniProt Synonym Gene Names
hCD83
UniProt Entry Name
CD83_HUMAN

NCBI Description

The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to dendritic cells and inhibit their maturation. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

CD83: May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p23

Cellular Component: integral to plasma membrane; plasma membrane; external side of plasma membrane

Biological Process: negative regulation of interleukin-4 production; positive regulation of interleukin-2 production; defense response; positive regulation of CD4-positive, alpha beta T cell differentiation; signal transduction; response to organic cyclic substance; positive regulation of interleukin-10 production; humoral immune response

Research Articles on CD83

Similar Products

Product Notes

The CD83 cd83 (Catalog #AAA3215090) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD83 Antibody - C-terminal region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's CD83 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD83 cd83 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GTYRCTLQDP DGQRNLSGKV ILRVTGCPAQ RKEETFKKYR AEIVLLLALV. It is sometimes possible for the material contained within the vial of "CD83, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.