Western Blot (WB)
(WB Suggested Anti-QRFPR AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Rabbit QRFPR Polyclonal Antibody | anti-QRFPR antibody
QRFPR antibody - C-terminal region
Gene Names
QRFPR; AQ27; GPR103; SP9155
Reactivity
Cow, Guinea Pig, Horse, Human, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
QRFPR; Polyclonal Antibody; QRFPR antibody - C-terminal region; anti-QRFPR antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FSLRENPVEETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSELAENS
Sequence Length
431
Applicable Applications for anti-QRFPR antibody
Western Blot (WB)
Homology
Cow: 85%; Guinea Pig: 85%; Horse: 79%; Human: 100%; Rabbit: 77%; Rat: 86%; Zebrafish: 75%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human QRFPR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-QRFPR AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Western Blot (WB)
(WB Suggested Anti-QRFPR AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-QRFPR antibody
This is a rabbit polyclonal antibody against QRFPR. It was validated on Western Blot
Target Description: G protein-coupled receptors (GPCRs, or GPRs) contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins.
Target Description: G protein-coupled receptors (GPCRs, or GPRs) contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins.
Product Categories/Family for anti-QRFPR antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
pyroglutamylated RF-amide peptide receptor
NCBI Official Synonym Full Names
pyroglutamylated RFamide peptide receptor
NCBI Official Symbol
QRFPR
NCBI Official Synonym Symbols
AQ27; GPR103; SP9155
NCBI Protein Information
pyroglutamylated RF-amide peptide receptor; pyroglutamylated RFamide peptide receptor
UniProt Protein Name
Pyroglutamylated RFamide peptide receptor
Protein Family
UniProt Gene Name
QRFPR
UniProt Synonym Gene Names
GPR103
UniProt Entry Name
QRFPR_HUMAN
Uniprot Description
GPR103: Receptor for the orexigenic neuropeptide QRFP. The activity of this receptor is mediated by G proteins that modulate adenylate cyclase activity and intracellular calcium levels. Belongs to the G-protein coupled receptor 1 family.
Protein type: Receptor, GPCR; Membrane protein, multi-pass; GPCR, family 1; Membrane protein, integral
Chromosomal Location of Human Ortholog: 4q27
Cellular Component: integral to plasma membrane; integral to membrane; plasma membrane
Molecular Function: G-protein coupled receptor activity; neuropeptide Y receptor activity; peptide binding
Biological Process: G-protein coupled receptor protein signaling pathway; neuropeptide signaling pathway; cellular response to hormone stimulus
Research Articles on QRFPR
Similar Products
Product Notes
The QRFPR qrfpr (Catalog #AAA3214817) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The QRFPR antibody - C-terminal region reacts with Cow, Guinea Pig, Horse, Human, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's QRFPR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the QRFPR qrfpr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FSLRENPVEE TKGEAFSDGN IEVKLCEQTE EKKKLKRHLA LFRSELAENS. It is sometimes possible for the material contained within the vial of "QRFPR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
