Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GNAT1 antibody Titration: 1 ug/mLSample Type: Human Lung Tumor)

Rabbit GNAT1 Polyclonal Antibody | anti-GNAT1 antibody

GNAT1 Antibody - N-terminal region

Gene Names
GNAT1; GBT1; GNATR; CSNB1G; CSNBAD3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity purified
Synonyms
GNAT1; Polyclonal Antibody; GNAT1 Antibody - N-terminal region; anti-GNAT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YSLEECLEFIAIIYGNTLQSILAIVRAMTTLNIQYGDSARQDDARKLMHM
Sequence Length
350
Applicable Applications for anti-GNAT1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 77%; Rat: 100%; Sheep: 77%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GNAT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GNAT1 antibody Titration: 1 ug/mLSample Type: Human Lung Tumor)

Western Blot (WB) (WB Suggested Anti-GNAT1 antibody Titration: 1 ug/mLSample Type: Human Lung Tumor)
Related Product Information for anti-GNAT1 antibody
This is a rabbit polyclonal antibody against GNAT1. It was validated on Western Blot

Target Description: Transducin is a 3-subunit guanine nucleotide-binding protein (G protein) which stimulates the coupling of rhodopsin and cGMP-phoshodiesterase during visual impulses. The transducin alpha subunits in rods and cones are encoded by separate genes. This gene encodes the alpha subunit in rods. This gene is also expressed in other cells, and has been implicated in bitter taste transduction in rat taste cells. Mutations in this gene result in autosomal dominant congenital stationary night blindness. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Product Categories/Family for anti-GNAT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
guanine nucleotide-binding protein G(t) subunit alpha-1
NCBI Official Synonym Full Names
G protein subunit alpha transducin 1
NCBI Official Symbol
GNAT1
NCBI Official Synonym Symbols
GBT1; GNATR; CSNB1G; CSNBAD3
NCBI Protein Information
guanine nucleotide-binding protein G(t) subunit alpha-1
UniProt Protein Name
Guanine nucleotide-binding protein G(t) subunit alpha-1
UniProt Gene Name
GNAT1
UniProt Synonym Gene Names
GNATR
UniProt Entry Name
GNAT1_HUMAN

NCBI Description

Transducin is a 3-subunit guanine nucleotide-binding protein (G protein) which stimulates the coupling of rhodopsin and cGMP-phoshodiesterase during visual impulses. The transducin alpha subunits in rods and cones are encoded by separate genes. This gene encodes the alpha subunit in rods. This gene is also expressed in other cells, and has been implicated in bitter taste transduction in rat taste cells. Mutations in this gene result in autosomal dominant congenital stationary night blindness. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Feb 2009]

Uniprot Description

G-alpha t1: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Transducin is an amplifier and one of the transducers of a visual impulse that performs the coupling between rhodopsin and cGMP-phosphodiesterase. Defects in GNAT1 are the cause of congenital stationary night blindness autosomal dominant type 3 (CSNBAD3); also known as congenital stationary night blindness Nougaret type. Congenital stationary night blindness is a non-progressive retinal disorder characterized by impaired night vision. Belongs to the G-alpha family. G(i/o/t/z) subfamily.

Protein type: G protein, heterotrimeric alpha G((i/o/t/z)); G protein; G protein, heterotrimeric

Chromosomal Location of Human Ortholog: 3p21

Cellular Component: photoreceptor outer segment; photoreceptor inner segment; membrane; cell soma; apical plasma membrane; plasma membrane; heterotrimeric G-protein complex; cytosol; photoreceptor connecting cilium

Molecular Function: GTPase activity; signal transducer activity; GDP binding; acyl binding; G-protein-coupled receptor binding; GTP binding; metal ion binding; G-protein beta/gamma-subunit binding; protein kinase binding

Biological Process: phototransduction, visible light; response to light stimulus; sensory perception of umami taste; metabolic process; response to light intensity; detection of chemical stimulus involved in sensory perception of bitter taste; signal transduction; rhodopsin mediated signaling; G-protein signaling, coupled to cAMP nucleotide second messenger; cell proliferation; eye photoreceptor cell development; regulation of rhodopsin mediated signaling; visual perception; retina development in camera-type eye; detection of light stimulus involved in visual perception; positive regulation of cyclic-nucleotide phosphodiesterase activity; negative regulation of cyclic-nucleotide phosphodiesterase activity

Disease: Night Blindness, Congenital Stationary, Type 1g; Night Blindness, Congenital Stationary, Autosomal Dominant 3

Research Articles on GNAT1

Similar Products

Product Notes

The GNAT1 gnat1 (Catalog #AAA3214565) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNAT1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GNAT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GNAT1 gnat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YSLEECLEFI AIIYGNTLQS ILAIVRAMTT LNIQYGDSAR QDDARKLMHM. It is sometimes possible for the material contained within the vial of "GNAT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.