Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GRM2 antibody Titration: 1 ug/mLSample Type: Human Uterus Tumor)

Rabbit GRM2 Polyclonal Antibody | anti-GRM2 antibody

GRM2 Antibody - C-terminal region

Gene Names
GRM2; GLUR2; mGlu2; GPRC1B; MGLUR2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
GRM2; Polyclonal Antibody; GRM2 Antibody - C-terminal region; anti-GRM2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AWLVVEAPGTGKETAPERREVVTLRCNHRDASMLGSLAYNVLLIALCTLY
Sequence Length
872
Applicable Applications for anti-GRM2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human GRM2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GRM2 antibody Titration: 1 ug/mLSample Type: Human Uterus Tumor)

Western Blot (WB) (WB Suggested Anti-GRM2 antibody Titration: 1 ug/mLSample Type: Human Uterus Tumor)
Related Product Information for anti-GRM2 antibody
This is a rabbit polyclonal antibody against GRM2. It was validated on Western Blot

Target Description: L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-GRM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95 kDa
NCBI Official Synonym Full Names
glutamate metabotropic receptor 2
NCBI Official Symbol
GRM2
NCBI Official Synonym Symbols
GLUR2; mGlu2; GPRC1B; MGLUR2
NCBI Protein Information
metabotropic glutamate receptor 2
UniProt Protein Name
Metabotropic glutamate receptor 2
UniProt Gene Name
GRM2
UniProt Synonym Gene Names
GPRC1B; MGLUR2; mGluR2
UniProt Entry Name
GRM2_HUMAN

NCBI Description

L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2017]

Uniprot Description

mGluR2: Receptor for glutamate. The activity of this receptor is mediated by a G-protein that inhibits adenylate cyclase activity. May mediate suppression of neurotransmission or may be involved in synaptogenesis or synaptic stabilization. Belongs to the G-protein coupled receptor 3 family.

Protein type: GPCR, family 3; Membrane protein, multi-pass; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3p21.2

Cellular Component: presynaptic membrane; integral to plasma membrane; axon; dendrite; plasma membrane; intracellular; cell junction

Molecular Function: G-protein coupled receptor activity; group II metabotropic glutamate receptor activity; calcium channel regulator activity; glutamate receptor activity

Biological Process: synaptic transmission; regulation of synaptic transmission, glutamatergic; glutamate secretion; negative regulation of adenylate cyclase activity; metabotropic glutamate receptor, adenylate cyclase inhibiting pathway

Research Articles on GRM2

Similar Products

Product Notes

The GRM2 grm2 (Catalog #AAA3214414) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRM2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GRM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GRM2 grm2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AWLVVEAPGT GKETAPERRE VVTLRCNHRD ASMLGSLAYN VLLIALCTLY. It is sometimes possible for the material contained within the vial of "GRM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.