Western Blot (WB)
(WB Suggested Anti-NPFFR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)
Rabbit anti-Human NPFFR2 Polyclonal Antibody | anti-NPFFR2 antibody
NPFFR2 antibody - C-terminal region
Gene Names
NPFFR2; GPR74; NPFF2; NPGPR; HLWAR77
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NPFFR2; Polyclonal Antibody; NPFFR2 antibody - C-terminal region; anti-NPFFR2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KAKSHVLINTSNQLVQESTFQNPHGETLLYRKSAEKPQQELVMEELKETT
Sequence Length
420
Applicable Applications for anti-NPFFR2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NPFFR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-NPFFR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)
Western Blot (WB)
(WB Suggested Anti-NPFFR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)
Related Product Information for anti-NPFFR2 antibody
This is a rabbit polyclonal antibody against NPFFR2. It was validated on Western Blot
Target Description: This gene encodes a member of a subfamily of G-protein-coupled neuropeptide receptors. This protein is activated by the neuropeptides A-18-amide (NPAF) and F-8-amide (NPFF) and may function in pain modulation and regulation of the opioid system. Alternative splicing results in multiple transcript variants.
Target Description: This gene encodes a member of a subfamily of G-protein-coupled neuropeptide receptors. This protein is activated by the neuropeptides A-18-amide (NPAF) and F-8-amide (NPFF) and may function in pain modulation and regulation of the opioid system. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-NPFFR2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
46kDa
NCBI Official Full Name
neuropeptide FF receptor 2 isoform 2
NCBI Official Synonym Full Names
neuropeptide FF receptor 2
NCBI Official Symbol
NPFFR2
NCBI Official Synonym Symbols
GPR74; NPFF2; NPGPR; HLWAR77
NCBI Protein Information
neuropeptide FF receptor 2
UniProt Protein Name
Neuropeptide FF receptor 2
Protein Family
UniProt Gene Name
NPFFR2
UniProt Entry Name
A0PJM9_HUMAN
NCBI Description
This gene encodes a member of a subfamily of G-protein-coupled neuropeptide receptors. This protein is activated by the neuropeptides A-18-amide (NPAF) and F-8-amide (NPFF) and may function in pain modulation and regulation of the opioid system. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2009]
Research Articles on NPFFR2
Similar Products
Product Notes
The NPFFR2 npffr2 (Catalog #AAA3214399) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NPFFR2 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NPFFR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NPFFR2 npffr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KAKSHVLINT SNQLVQESTF QNPHGETLLY RKSAEKPQQE LVMEELKETT. It is sometimes possible for the material contained within the vial of "NPFFR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
