Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SIPA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysate)

Rabbit anti-Human SIPA1 Polyclonal Antibody | anti-SIPA1 antibody

SIPA1 antibody - middle region

Gene Names
SIPA1; SPA1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SIPA1; Polyclonal Antibody; SIPA1 antibody - middle region; anti-SIPA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLRNS
Sequence Length
1042
Applicable Applications for anti-SIPA1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SIPA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SIPA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysate)

Western Blot (WB) (WB Suggested Anti-SIPA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysate)
Related Product Information for anti-SIPA1 antibody
This is a rabbit polyclonal antibody against SIPA1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The product of this gene is a mitogen induced GTPase activating protein (GAP). It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases. This protein may also hamper mitogen-induced cell
Product Categories/Family for anti-SIPA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
112kDa
NCBI Official Full Name
signal-induced proliferation-associated protein 1
NCBI Official Synonym Full Names
signal-induced proliferation-associated 1
NCBI Official Symbol
SIPA1
NCBI Official Synonym Symbols
SPA1
NCBI Protein Information
signal-induced proliferation-associated protein 1
UniProt Protein Name
Signal-induced proliferation-associated protein 1
UniProt Gene Name
SIPA1
UniProt Synonym Gene Names
SPA1; Sipa-1
UniProt Entry Name
SIPA1_HUMAN

NCBI Description

The product of this gene is a mitogen induced GTPase activating protein (GAP). It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases. This protein may also hamper mitogen-induced cell cycle progression when abnormally or prematurely expressed. It is localized to the perinuclear region. Two alternatively spliced variants encoding the same isoform have been characterized to date. [provided by RefSeq, Jul 2008]

Uniprot Description

SIPA1: GTPase activator for the nuclear Ras-related regulatory proteins Rap1 and Rap2 in vitro, converting it to the putatively inactive GDP-bound state.

Protein type: GAPs, Ras; GAPs

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: Golgi apparatus; transport vesicle; protein complex; perinuclear region of cytoplasm; nucleolus; plasma membrane; cytosol; nucleus

Molecular Function: protein C-terminus binding; protein binding; GTPase activator activity

Biological Process: cell proliferation; cellular response to water deprivation; cytoskeleton organization and biogenesis; negative regulation of cell adhesion; negative regulation of cell growth; signal transduction; negative regulation of cell cycle; positive regulation of GTPase activity

Research Articles on SIPA1

Similar Products

Product Notes

The SIPA1 sipa1 (Catalog #AAA3214052) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SIPA1 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SIPA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SIPA1 sipa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TAKPSVPSAD SETPLTQDRP GSPSGSEDKG NPAPELRASF LPRTLSLRNS. It is sometimes possible for the material contained within the vial of "SIPA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.