Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-BPNT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysate)

Rabbit BPNT1 Polyclonal Antibody | anti-BPNT1 antibody

BPNT1 antibody - N-terminal region

Gene Names
BPNT1; PIP; HEL20
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
BPNT1; Polyclonal Antibody; BPNT1 antibody - N-terminal region; anti-BPNT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP
Sequence Length
261
Applicable Applications for anti-BPNT1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 100%; Rat: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human BPNT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-BPNT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-BPNT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysate)
Related Product Information for anti-BPNT1 antibody
This is a rabbit polyclonal antibody against BPNT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
3'(2'),5'-bisphosphate nucleotidase 1 isoform 1
NCBI Official Synonym Full Names
3'(2'), 5'-bisphosphate nucleotidase 1
NCBI Official Symbol
BPNT1
NCBI Official Synonym Symbols
PIP; HEL20
NCBI Protein Information
3'(2'),5'-bisphosphate nucleotidase 1
UniProt Protein Name
3'(2'),5'-bisphosphate nucleotidase 1
UniProt Gene Name
BPNT1
UniProt Synonym Gene Names
PIP
UniProt Entry Name
BPNT1_HUMAN

NCBI Description

BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity. [provided by RefSeq, Jul 2008]

Uniprot Description

BPNT1: Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate (Ins(1,4)P2) and inositol 1,3,4- trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins(1)P, Ins(3,4)P2, Ins(1,3,4,5)P4 or InsP6. Belongs to the inositol monophosphatase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Phosphatase (non-protein); Energy Metabolism - sulfur; EC 3.1.3.7

Chromosomal Location of Human Ortholog: 1q41

Cellular Component: cytosol

Molecular Function: inositol-1,4-bisphosphate 1-phosphatase activity; magnesium ion binding; 3'(2'),5'-bisphosphate nucleotidase activity

Biological Process: nervous system development; dephosphorylation; phosphoinositide phosphorylation; xenobiotic metabolic process; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process; 3'-phosphoadenosine 5'-phosphosulfate metabolic process

Research Articles on BPNT1

Similar Products

Product Notes

The BPNT1 bpnt1 (Catalog #AAA3213971) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BPNT1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BPNT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BPNT1 bpnt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DRVTIQELTA PLLTTAQAKP GETQEEETNS GEEPFIETPR QDGVSRRFIP. It is sometimes possible for the material contained within the vial of "BPNT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.