Western Blot (WB)
(WB Suggested Anti-Usp27x AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)
Rabbit Usp27x Polyclonal Antibody | anti-USP27X antibody
Usp27x antibody - middle region
Gene Names
Usp27x; Sfc11; Usp27
Reactivity
Tested: MousePredicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Usp27x; Polyclonal Antibody; Usp27x antibody - middle region; anti-USP27X antibody
Host
Rabbit
Reactivity
Tested: Mouse
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CIVQALTHTPILRDFFLSDRHRCEMPSPELCLVCEMSSLFRELYSGNPSP
Sequence Length
519
Applicable Applications for anti-USP27X antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 85%; Zebrafish: 100%
Protein Size (#AA)
519 amino acids
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Usp27x AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)
Western Blot (WB)
(WB Suggested Anti-Usp27x AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)
Related Product Information for anti-USP27X antibody
This is a rabbit polyclonal antibody against Usp27x. It was validated on Western Blot
Target Description: The function of this protein remains unknown.
Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-USP27X antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 27
NCBI Official Synonym Full Names
ubiquitin specific peptidase 27, X chromosome
NCBI Official Symbol
Usp27x
NCBI Official Synonym Symbols
Sfc11; Usp27
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 27
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 27
UniProt Gene Name
Usp27
UniProt Synonym Gene Names
Usp27x
Uniprot Description
Deubiquitinase that can reduce the levels of BCL2L11/BIM ubiquitination and stabilize BCL2L11 in response to the RAF-MAPK-degradation signal. By acting on BCL2L11 levels, may counteract the anti-apoptotic effects of MAPK activity.
Research Articles on USP27X
Similar Products
Product Notes
The USP27X usp27 (Catalog #AAA3213853) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Usp27x antibody - middle region reacts with Tested: Mouse Predicted: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Usp27x can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the USP27X usp27 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CIVQALTHTP ILRDFFLSDR HRCEMPSPEL CLVCEMSSLF RELYSGNPSP. It is sometimes possible for the material contained within the vial of "Usp27x, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
