Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NRLSample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit NRL Polyclonal Antibody | anti-NRL antibody

NRL Antibody - C-terminal region

Gene Names
NRL; RP27; D14S46E; NRL-MAF
Reactivity
Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NRL; Polyclonal Antibody; NRL Antibody - C-terminal region; anti-NRL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLF
Sequence Length
237
Applicable Applications for anti-NRL antibody
Western Blot (WB)
Homology
Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human NRL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NRLSample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NRLSample Type: Esophagus Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NRL antibody
This is a rabbit polyclonal antibody against NRL. It was validated on Western Blot

Target Description: This gene encodes a basic motif-leucine zipper transcription factor of the Maf subfamily. The encoded protein is conserved among vertebrates and is a critical intrinsic regulator of photoceptor development and function. Mutations in this gene have been associated with retinitis pigmentosa and retinal degenerative diseases.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Synonym Full Names
neural retina leucine zipper
NCBI Official Symbol
NRL
NCBI Official Synonym Symbols
RP27; D14S46E; NRL-MAF
NCBI Protein Information
neural retina-specific leucine zipper protein
UniProt Protein Name
Neural retina-specific leucine zipper protein
UniProt Gene Name
NRL
UniProt Synonym Gene Names
D14S46E; NRL
UniProt Entry Name
NRL_HUMAN

NCBI Description

This gene encodes a basic motif-leucine zipper transcription factor of the Maf subfamily. The encoded protein is conserved among vertebrates and is a critical intrinsic regulator of photoceptor development and function. Mutations in this gene have been associated with retinitis pigmentosa and retinal degenerative diseases. [provided by RefSeq, Jul 2008]

Uniprot Description

NRL: Transcription factor which regulates the expression of several rod-specific genes, in cluding RHO and PDE6B. Defects in NRL are the cause of retinitis pigmentosa type 27 (RP27). RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. RP27 inheritance is autosomal dominant. Defects in NRL are a cause of retinal degeneration autosomal recessive clumped pigment type (RDCP). A retinopathy characterized by night blindness since early childhood, consistent with a severe reduction in rod function. Color vision is normal although there is a relatively enhanced function of short-wavelength-sensitive cones in the macula. Signs of retinal degeneration and clusters of clumped pigment deposits in the peripheral fundus at the level of the retinal pigment epithelium are present (clumped pigmentary retinal degeneration). Belongs to the bZIP family.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 14q11.1-q11.2

Cellular Component: nucleus

Molecular Function: leucine zipper domain binding; protein binding; DNA binding

Biological Process: transcription from RNA polymerase II promoter; retinal rod cell development; visual perception; positive regulation of rhodopsin gene expression; response to stimulus; positive regulation of transcription from RNA polymerase II promoter; regulation of rhodopsin gene expression

Disease: Retinitis Pigmentosa 27

Research Articles on NRL

Similar Products

Product Notes

The NRL nrl (Catalog #AAA3213772) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NRL Antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NRL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NRL nrl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEAERARLAA QLDALRAEVA RLARERDLYK ARCDRLTSSG PGSGDPSHLF. It is sometimes possible for the material contained within the vial of "NRL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.