Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HNF1ASample Type: HepG2Antibody Dilution: 1.0ug/ml)

Rabbit HNF1A Polyclonal Antibody | anti-HNF1A antibody

HNF1A antibody - N-terminal region

Gene Names
HNF1A; HNF1; LFB1; TCF1; HNF4A; MODY3; TCF-1; HNF-1A; IDDM20
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HNF1A; Polyclonal Antibody; HNF1A antibody - N-terminal region; anti-HNF1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE
Sequence Length
631
Applicable Applications for anti-HNF1A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human HNF1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HNF1ASample Type: HepG2Antibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HNF1ASample Type: HepG2Antibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: HNF1ASample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HNF1ASample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: HNF1ASample Type: Human Fetal StomachAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HNF1ASample Type: Human Fetal StomachAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Sample Type: Human Liver Carcinoma (HepG2 lysate)10-40ug lysate/lanePrimary Dilution: 1:1000Secondary: Alexa Fluor 680 Donkey Anti-Rabbit IgG Invitrogen Secondary Dilution: 1:30,000HNF1A is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Western Blot (WB) (Sample Type: Human Liver Carcinoma (HepG2 lysate)10-40ug lysate/lanePrimary Dilution: 1:1000Secondary: Alexa Fluor 680 Donkey Anti-Rabbit IgG Invitrogen Secondary Dilution: 1:30,000HNF1A is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Western Blot (WB)

(WB Suggested Anti-HNF1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human kidney)

Western Blot (WB) (WB Suggested Anti-HNF1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human kidney)
Related Product Information for anti-HNF1A antibody
This is a rabbit polyclonal antibody against HNF1A. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: HNF1A is required for the expression of several liver specific genes. HNF1A binds to the inverted palindrome 5'-GTTAATNATTAAC-3'.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
hepatocyte nuclear factor 1-alpha isoform 2
NCBI Official Synonym Full Names
HNF1 homeobox A
NCBI Official Symbol
HNF1A
NCBI Official Synonym Symbols
HNF1; LFB1; TCF1; HNF4A; MODY3; TCF-1; HNF-1A; IDDM20
NCBI Protein Information
hepatocyte nuclear factor 1-alpha
UniProt Protein Name
Hepatocyte nuclear factor 1-alpha
Protein Family
UniProt Gene Name
HNF1A
UniProt Synonym Gene Names
TCF1; HNF-1-alpha; HNF-1A; LFB1; TCF-1
UniProt Entry Name
HNF1A_HUMAN

NCBI Description

The protein encoded by this gene is a transcription factor required for the expression of several liver-specific genes. The encoded protein functions as a homodimer and binds to the inverted palindrome 5'-GTTAATNATTAAC-3'. Defects in this gene are a cause of maturity onset diabetes of the young type 3 (MODY3) and also can result in the appearance of hepatic adenomas. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2015]

Uniprot Description

HNF1A: Transcriptional activator that regulates the tissue specific expression of multiple genes, especially in pancreatic islet cells and in liver. Required for the expression of several liver specific genes. Binds to the inverted palindrome 5'- GTTAATNATTAAC-3'. Defects in HNF1A are a cause of hepatic adenomas familial (HEPAF). Hepatic adenomas are rare benign liver tumors of presumable epithelial origin that develop in an otherwise normal liver. Hepatic adenomas may be single or multiple. They consist of sheets of well-differentiated hepatocytes that contain fat and glycogen and can produce bile. Bile ducts or portal areas are absent. Kupffer cells, if present, are reduced in number and are non-functional. Conditions associated with adenomas are insulin-dependent diabetes mellitus and glycogen storage diseases (types 1 and 3). Bi-allelic inactivation of HNF1A, whether sporadic or associated with MODY3, may be an early step in the developmant of some hepatocellular carcinomas. Defects in HNF1A are the cause of maturity-onset diabetes of the young type 3 (MODY3); also symbolized MODY-3. MODY is a form of diabetes that is characterized by an autosomal dominant mode of inheritance, onset in childhood or early adulthood (usually before 25 years of age), a primary defect in insulin secretion and frequent insulin-independence at the beginning of the disease. Defects in HNF1A are the cause of susceptibility to diabetes mellitus insulin-dependent type 20 (IDDM20). IDDM20 is a multifactorial disorder of glucose homeostasis that is characterized by susceptibility to ketoacidosis in the absence of insulin therapy. Clinical fetaures are polydipsia, polyphagia and polyuria which result from hyperglycemia-induced osmotic diuresis and secondary thirst. These features can result in long-term complications that affect the eyes, kidneys, nerves, and blood vessels. Belongs to the HNF1 homeobox family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 12q24.2

Cellular Component: nucleoplasm; protein complex; cytoplasm; nucleus

Molecular Function: protein dimerization activity; protein binding; protein homodimerization activity; DNA binding; protein heterodimerization activity; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription, DNA-dependent; insulin secretion; glucose import; positive regulation of transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; glucose homeostasis

Disease: Diabetes Mellitus, Insulin-dependent, 20; Diabetes Mellitus, Insulin-dependent; Hepatic Adenomas, Familial; Maturity-onset Diabetes Of The Young, Type 3; Renal Cell Carcinoma, Nonpapillary; Diabetes Mellitus, Noninsulin-dependent

Research Articles on HNF1A

Similar Products

Product Notes

The HNF1A hnf1a (Catalog #AAA3213623) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HNF1A antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HNF1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HNF1A hnf1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HAGQGGLIEE PTGDELPTKK GRRNRFKWGP ASQQILFQAY ERQKNPSKEE. It is sometimes possible for the material contained within the vial of "HNF1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.