Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Pa2g4 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)

Rabbit Pa2g4 Polyclonal Antibody | anti-PA2G4 antibody

Pa2g4 antibody - C-terminal region

Gene Names
Pa2g4; Ebp1; 38kDa; Plfap; AA672939
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Pa2g4; Polyclonal Antibody; Pa2g4 antibody - C-terminal region; anti-PA2G4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PDLYKSEMEVQDAELKALLQSSASRKTQKKKKKKASKTVENATSGETLEE
Sequence Length
394
Applicable Applications for anti-PA2G4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 91%; Zebrafish: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Pa2g4 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)

Western Blot (WB) (WB Suggested Anti-Pa2g4 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)
Related Product Information for anti-PA2G4 antibody
This is a rabbit polyclonal antibody against Pa2g4. It was validated on Western Blot

Target Description: Pa2g4 may play a role in a ERBB3-regulated signal transduction pathway. It seems be involved in growth regulation. It acts a corepressor of the androgen receptor (AR) and is regulated by the ERBB3 ligand neuregulin-1/heregulin (HRG). It inhibits transcription of some E2F1-regulated promoters, probably by recruiting histone acetylase (HAT) activity. It may be involved in ribosome assembly. It mediates cap-independent translation of specific viral IRESs (internal ribosomal entry site). It together with PTBP1 is required for the translation initiation on the foot-and-mouth disease virus (FMDV) IRES.
Product Categories/Family for anti-PA2G4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
proliferation-associated protein 2G4
NCBI Official Synonym Full Names
proliferation-associated 2G4
NCBI Official Symbol
Pa2g4
NCBI Official Synonym Symbols
Ebp1; 38kDa; Plfap; AA672939
NCBI Protein Information
proliferation-associated protein 2G4
UniProt Protein Name
Proliferation-associated protein 2G4
UniProt Gene Name
Pa2g4
UniProt Synonym Gene Names
Ebp1; Plfap; ITAF45
UniProt Entry Name
PA2G4_MOUSE

Uniprot Description

Ebp1: May play a role in a ERBB3-regulated signal transduction pathway. Seems be involved in growth regulation. Acts a corepressor of the androgen receptor (AR) and is regulated by the ERBB3 ligand neuregulin-1/heregulin (HRG). Inhibits transcription of some E2F1-regulated promoters, probably by recruiting histone acetylase (HAT) activity. Binds RNA. Associates with 28S, 18S and 5.8S mature rRNAs, several rRNA precursors and probably U3 small nucleolar RNA. May be involved in regulation of intermediate and late steps of rRNA processing. May be involved in ribosome assembly. Mediates cap-independent translation of specific viral IRESs (internal ribosomal entry site). Belongs to the peptidase M24 family.

Protein type: Transcription, coactivator/corepressor; Nucleolus; Nuclear receptor co-regulator

Cellular Component: cytoplasm; membrane; nucleolus; nucleoplasm; nucleus; ribonucleoprotein complex

Molecular Function: DNA binding; RNA binding; transcription factor activity; ubiquitin protein ligase binding

Biological Process: negative regulation of apoptosis; negative regulation of transcription, DNA-dependent; positive regulation of cell differentiation; regulation of transcription, DNA-dependent; regulation of translation; rRNA processing; transcription, DNA-dependent

Research Articles on PA2G4

Similar Products

Product Notes

The PA2G4 pa2g4 (Catalog #AAA3213611) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Pa2g4 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Pa2g4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PA2G4 pa2g4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PDLYKSEMEV QDAELKALLQ SSASRKTQKK KKKKASKTVE NATSGETLEE. It is sometimes possible for the material contained within the vial of "Pa2g4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.