Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NECAB3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysateNECAB3 is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit NECAB3 Polyclonal Antibody | anti-NECAB3 antibody

NECAB3 antibody - middle region

Gene Names
NECAB3; NIP1; XB51; STIP3; EFCBP3; SYTIP2; APBA2BP; dJ63M2.4; dJ63M2.5
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NECAB3; Polyclonal Antibody; NECAB3 antibody - middle region; anti-NECAB3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQV
Sequence Length
396
Applicable Applications for anti-NECAB3 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NECAB3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NECAB3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysateNECAB3 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (WB Suggested Anti-NECAB3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysateNECAB3 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-NECAB3 antibody
This is a rabbit polyclonal antibody against NECAB3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-NECAB3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
N-terminal EF-hand calcium-binding protein 3 isoform 2
NCBI Official Synonym Full Names
N-terminal EF-hand calcium binding protein 3
NCBI Official Symbol
NECAB3
NCBI Official Synonym Symbols
NIP1; XB51; STIP3; EFCBP3; SYTIP2; APBA2BP; dJ63M2.4; dJ63M2.5
NCBI Protein Information
N-terminal EF-hand calcium-binding protein 3
UniProt Protein Name
N-terminal EF-hand calcium-binding protein 3
UniProt Gene Name
NECAB3
UniProt Synonym Gene Names
APBA2BP; NIP1; SYTIP2; XB51
UniProt Entry Name
NECA3_HUMAN

NCBI Description

The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

NECAB3: Inhibits the interaction of APBA2 with beta-amyloid precursor protein (APP), and hence allows formation of beta- amyloid. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 20q11.22

Cellular Component: endoplasmic reticulum membrane; cytoplasm; Golgi cis cisterna; nucleus

Molecular Function: protein binding; calcium ion binding

Biological Process: regulation of amyloid precursor protein biosynthetic process; protein metabolic process; protein secretion

Research Articles on NECAB3

Similar Products

Product Notes

The NECAB3 necab3 (Catalog #AAA3213492) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NECAB3 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NECAB3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NECAB3 necab3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESVEAQSRLC GSRRAGRRAL RSVSRSSTWS PGSSDTGRSS EAEMQWRLQV. It is sometimes possible for the material contained within the vial of "NECAB3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.