<
Western Blot (WB)
(DCUN1D1 monoclonal antibody (M02), clone 4B5. Western Blot analysis of DCUN1D1 expression in HepG2 (Cat # L019V1).)
Mouse DCUN1D1 Monoclonal Antibody | anti-DCUN1D1 antibody
DCUN1D1 (DCN1, Defective in Cullin Neddylation 1, Domain Containing 1 (S. cerevisiae), DCUN1L1, RP42, SCCRO, SCRO, Tes3) (PE)
Gene Names
DCUN1D1; RP42; SCRO; Tes3; DCNL1; SCCRO; DCUN1L1
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
DCUN1D1; Monoclonal Antibody; DCUN1D1 (DCN1; Defective in Cullin Neddylation 1; Domain Containing 1 (S. cerevisiae); DCUN1L1; RP42; SCCRO; SCRO; Tes3) (PE); DCN1; Tes3; anti-DCUN1D1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4B5
Specificity
Recognizes DCUN1D1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-DCUN1D1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
DCUN1D1 (NP_065691, 1aa-89aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQF
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(DCUN1D1 monoclonal antibody (M02), clone 4B5. Western Blot analysis of DCUN1D1 expression in HepG2 (Cat # L019V1).)
Western Blot (WB)
(DCUN1D1 monoclonal antibody (M02), clone 4B5. Western Blot analysis of DCUN1D1 expression in HepG2 (Cat # L019V1).)
Western Blot (WB)
(DCUN1D1 monoclonal antibody (M02), clone 4B5. Western Blot analysis of DCUN1D1 expression in NIH/3T3.)
Western Blot (WB)
(DCUN1D1 monoclonal antibody (M02), clone 4B5. Western Blot analysis of DCUN1D1 expression in NIH/3T3.)
Western Blot (WB)
(DCUN1D1 monoclonal antibody (M02), clone 4B5. Western Blot analysis of DCUN1D1 expression in PC-12.)
Western Blot (WB)
(DCUN1D1 monoclonal antibody (M02), clone 4B5. Western Blot analysis of DCUN1D1 expression in PC-12.)
Western Blot (WB)
(DCUN1D1 monoclonal antibody (M02), clone 4B5. Western Blot analysis of DCUN1D1 expression in Raw 264.7.)
Western Blot (WB)
(DCUN1D1 monoclonal antibody (M02), clone 4B5. Western Blot analysis of DCUN1D1 expression in Raw 264.7.)
Related Product Information for anti-DCUN1D1 antibody
Mouse monoclonal antibody raised against a partial recombinant DCUN1D1.
Product Categories/Family for anti-DCUN1D1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
32.2 kDa (279aa), confirmed by MALDI-TOF
NCBI Official Full Name
DCN1-like protein 1 isoform 1
NCBI Official Synonym Full Names
defective in cullin neddylation 1 domain containing 1
NCBI Official Symbol
DCUN1D1
NCBI Official Synonym Symbols
RP42; SCRO; Tes3; DCNL1; SCCRO; DCUN1L1
NCBI Protein Information
DCN1-like protein 1
UniProt Protein Name
DCN1-like protein 1
Protein Family
UniProt Gene Name
DCUN1D1
UniProt Synonym Gene Names
DCUN1L1; RP42; SCCRO
UniProt Entry Name
DCNL1_HUMAN
Uniprot Description
DCUN1D1: Part of an E3 ubiquitin ligase complex for neddylation. Required for neddylation of cullin components of E3 cullin-RING ubiquitin ligase complexes by enhancing the rate of cullins neddylation. Functions to recruit the NEDD8-charged E2 enzyme to the cullin component. Involved in the release of inhibitory effets of CAND1 on cullin-RING ligase E3 complex assembly and activity. Acts also as an oncogene facilitating malignant transformation and carcinogenic progression.
Protein type: Oncoprotein; Ubiquitin conjugating system
Chromosomal Location of Human Ortholog: 3q26.3
Cellular Component: ubiquitin ligase complex
Molecular Function: protein binding
Research Articles on DCUN1D1
Similar Products
Product Notes
The DCUN1D1 dcun1d1 (Catalog #AAA6185878) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DCUN1D1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DCUN1D1 dcun1d1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DCUN1D1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
