Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit CCDC76 Polyclonal Antibody | anti-TRMT13 antibody

CCDC76 antibody - N-terminal region

Gene Names
TRMT13; CCDC76
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CCDC76; Polyclonal Antibody; CCDC76 antibody - N-terminal region; anti-TRMT13 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE
Sequence Length
481
Applicable Applications for anti-TRMT13 antibody
Western Blot (WB)
Homology
Cow: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 85%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC76
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CCDC76 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

Related Product Information for anti-TRMT13 antibody
This is a rabbit polyclonal antibody against CCDC76. It was validated on Western Blot

Target Description: CCDC76 specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signature.
Product Categories/Family for anti-TRMT13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
tRNA:m(4)X modification enzyme TRM13 homolog
NCBI Official Synonym Full Names
tRNA methyltransferase 13 homolog
NCBI Official Symbol
TRMT13
NCBI Official Synonym Symbols
CCDC76
NCBI Protein Information
tRNA:m(4)X modification enzyme TRM13 homolog
UniProt Protein Name
tRNA:m(4)X modification enzyme TRM13 homolog
UniProt Gene Name
TRMT13
UniProt Synonym Gene Names
CCDC76

Uniprot Description

tRNA methylase which 2'-O-methylates cytidine4 in tRNA(Pro) and tRNA(Gly)(GCC), and adenosine4 in tRNA(His).

Similar Products

Product Notes

The TRMT13 trmt13 (Catalog #AAA3213302) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCDC76 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CCDC76 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRMT13 trmt13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QLAKHLKKCN SREKPKPDFY IQDINAGLRD ETEIPEQLVP ISSLSEEQLE. It is sometimes possible for the material contained within the vial of "CCDC76, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual