Western Blot (WB)
(WB Suggested Anti-EXOC6 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Small Intestine)
Rabbit EXOC6 Polyclonal Antibody | anti-EXOC6 antibody
EXOC6 antibody - middle region
Gene Names
EXOC6; SEC15; EXOC6A; SEC15L; Sec15p; SEC15L1; SEC15L3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EXOC6; Polyclonal Antibody; EXOC6 antibody - middle region; anti-EXOC6 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YRCLHIYSVLGDEETFENYYRKQRKKQARLVLQPQSNMHETVDGYRRYFT
Sequence Length
804
Applicable Applications for anti-EXOC6 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EXOC6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-EXOC6 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Small Intestine)
Western Blot (WB)
(WB Suggested Anti-EXOC6 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Small Intestine)
Related Product Information for anti-EXOC6 antibody
This is a rabbit polyclonal antibody against EXOC6. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.
Target Description: The product of this gene belongs to the SEC15 family. It is highly similar to the protein encoded by Saccharomyces cerevisiae SEC15 gene. This protein is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for anti-EXOC6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94kDa
NCBI Official Full Name
exocyst complex component 6 isoform a
NCBI Official Synonym Full Names
exocyst complex component 6
NCBI Official Symbol
EXOC6
NCBI Official Synonym Symbols
SEC15; EXOC6A; SEC15L; Sec15p; SEC15L1; SEC15L3
NCBI Protein Information
exocyst complex component 6
UniProt Protein Name
Exocyst complex component 6
Protein Family
UniProt Gene Name
EXOC6
UniProt Synonym Gene Names
SEC15A; SEC15L; SEC15L1
UniProt Entry Name
EXOC6_HUMAN
NCBI Description
The protein encoded by this gene is highly similar to the Saccharomyces cerevisiae SEC15 gene product, which is essential for vesicular traffic from the Golgi apparatus to the cell surface in yeast. It is one of the components of a multiprotein complex required for exocytosis. The 5' portion of this gene and two neighboring cytochrome p450 genes are included in a deletion that results in an autosomal-dominant form of nonsyndromic optic nerve aplasia (ONA). Alternative splicing and the use of alternative promoters results in multiple transcript variants. A paralogous gene encoding a similar protein is present on chromosome 2. [provided by RefSeq, Jan 2016]
Research Articles on EXOC6
Similar Products
Product Notes
The EXOC6 exoc6 (Catalog #AAA3213297) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EXOC6 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EXOC6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EXOC6 exoc6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YRCLHIYSVL GDEETFENYY RKQRKKQARL VLQPQSNMHE TVDGYRRYFT. It is sometimes possible for the material contained within the vial of "EXOC6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
