Western Blot (WB)
(WB Suggested Anti-LANCL2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)
Rabbit LANCL2 Polyclonal Antibody | anti-LANCL2 antibody
LANCL2 antibody - middle region
Gene Names
LANCL2; TASP; GPR69B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LANCL2; Polyclonal Antibody; LANCL2 antibody - middle region; anti-LANCL2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYK
Sequence Length
450
Applicable Applications for anti-LANCL2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LANCL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-LANCL2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)
Western Blot (WB)
(WB Suggested Anti-LANCL2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)
Related Product Information for anti-LANCL2 antibody
This is a rabbit polyclonal antibody against LANCL2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: LANCL2 is necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.
Target Description: LANCL2 is necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.
Product Categories/Family for anti-LANCL2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
lanC-like protein 2
NCBI Official Synonym Full Names
LanC like 2
NCBI Official Symbol
LANCL2
NCBI Official Synonym Symbols
TASP; GPR69B
NCBI Protein Information
lanC-like protein 2
UniProt Protein Name
LanC-like protein 2
Protein Family
UniProt Gene Name
LANCL2
UniProt Synonym Gene Names
GPR69B; TASP
UniProt Entry Name
LANC2_HUMAN
Uniprot Description
LANCL2: Necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes. Belongs to the LanC-like protein family.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 7q31.1-q31.33
Cellular Component: cortical actin cytoskeleton; cytoplasm; cytosol; nucleus; plasma membrane
Molecular Function: ATP binding; catalytic activity; GTP binding; phosphatidylinositol 3-phosphate binding; phosphatidylinositol-5-phosphate binding; protein binding
Biological Process: metabolic process; negative regulation of transcription, DNA-dependent; positive regulation of abscisic acid mediated signaling
Research Articles on LANCL2
Similar Products
Product Notes
The LANCL2 lancl2 (Catalog #AAA3213275) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LANCL2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's LANCL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LANCL2 lancl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EMVKPSIDYV RHKKFRSGNY PSSLSNETDR LVHWCHGAPG VIHMLMQAYK. It is sometimes possible for the material contained within the vial of "LANCL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
