Western Blot (WB)
(Host: RabbitTarget Name: C9orf40Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Rabbit C9orf40 Polyclonal Antibody | anti-C9ORF40 antibody
C9orf40 antibody - middle region
Reactivity
Horse, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C9orf40; Polyclonal Antibody; C9orf40 antibody - middle region; anti-C9ORF40 antibody
Host
Rabbit
Reactivity
Horse, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HNEEFWQYNTFQYWRNPLPPIDLADIEDLSEDTLTEATLQGRNEGAEVDM
Sequence Length
194
Applicable Applications for anti-C9ORF40 antibody
Western Blot (WB)
Homology
Horse: 79%; Human: 100%; Pig: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human C9orf40
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: C9orf40Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: C9orf40Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: C9orf40Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: C9orf40Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-C9orf40 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)
Western Blot (WB)
(WB Suggested Anti-C9orf40 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)
Related Product Information for anti-C9ORF40 antibody
This is a rabbit polyclonal antibody against C9orf40. It was validated on Western Blot
Target Description: The function of C9orf40 remains unknown.
Target Description: The function of C9orf40 remains unknown.
Product Categories/Family for anti-C9ORF40 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
uncharacterized protein C9orf40
NCBI Official Synonym Full Names
chromosome 9 open reading frame 40
NCBI Official Symbol
C9orf40
NCBI Protein Information
uncharacterized protein C9orf40
UniProt Protein Name
Uncharacterized protein C9orf40
UniProt Gene Name
C9orf40
UniProt Entry Name
CI040_HUMAN
Similar Products
Product Notes
The C9ORF40 c9orf40 (Catalog #AAA3213164) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C9orf40 antibody - middle region reacts with Horse, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's C9orf40 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the C9ORF40 c9orf40 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HNEEFWQYNT FQYWRNPLPP IDLADIEDLS EDTLTEATLQ GRNEGAEVDM. It is sometimes possible for the material contained within the vial of "C9orf40, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
