Western Blot (WB)
(WB Suggested Anti-ENOSF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysateENOSF1 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Rabbit ENOSF1 Polyclonal Antibody | anti-ENOSF1 antibody
ENOSF1 antibody - N-terminal region
Gene Names
ENOSF1; RTS; FUCD; TYMSAS
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ENOSF1; Polyclonal Antibody; ENOSF1 antibody - N-terminal region; anti-ENOSF1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIK
Sequence Length
443
Applicable Applications for anti-ENOSF1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Yeast: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ENOSF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ENOSF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysateENOSF1 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Western Blot (WB)
(WB Suggested Anti-ENOSF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysateENOSF1 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Related Product Information for anti-ENOSF1 antibody
This is a rabbit polyclonal antibody against ENOSF1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene was originally identified as a naturally occurring antisense transcript to the human thymidylate synthase gene. Alternate splice variants have been described, one of which (named rTSalpha) represents an alternate 3'UTR that is complementary to t
Target Description: This gene was originally identified as a naturally occurring antisense transcript to the human thymidylate synthase gene. Alternate splice variants have been described, one of which (named rTSalpha) represents an alternate 3'UTR that is complementary to t
Product Categories/Family for anti-ENOSF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
mitochondrial enolase superfamily member 1 isoform rTSbeta
NCBI Official Synonym Full Names
enolase superfamily member 1
NCBI Official Symbol
ENOSF1
NCBI Official Synonym Symbols
RTS; FUCD; TYMSAS
NCBI Protein Information
mitochondrial enolase superfamily member 1
UniProt Protein Name
Mitochondrial enolase superfamily member 1
Protein Family
UniProt Gene Name
ENOSF1
UniProt Synonym Gene Names
RTS; TYMSAS; rTS
UniProt Entry Name
ENOF1_HUMAN
NCBI Description
This gene can encode a mitochondrial enzyme that is thought to convert L-fuconate to 2-keto-3-deoxy-L-fuconate. This locus was originally identified as the source of antisense RNAs of the adjacent thymidylate synthase gene. Splice variants at this locus may contain an alternate 3' exon that is complementary to the 3'UTR and terminal intron of the thymidylate synthase (TS) RNA and may downregulate TS expression. [provided by RefSeq, Aug 2017]
Research Articles on ENOSF1
Similar Products
Product Notes
The ENOSF1 enosf1 (Catalog #AAA3213100) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ENOSF1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ENOSF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ENOSF1 enosf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MVRGRISRLS VRDVRFPTSL GGHGADAMHT DPDYSAAYVV IETDAEDGIK. It is sometimes possible for the material contained within the vial of "ENOSF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
