Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sample Type: Human Cervical Cancer, Mouse, Monkey FibroblastSample Type:1. Human Cervical Cancer Cell Lysate (15ug)2. Monkey Fibroblast Cell Lysate (15ug)Primary Dilution:1:1000Secondary Antibody: goat anti-RabbitSecondary Dilution:1:40,000Image Submitted by:Dr. Jakob Szwedo, Dr. Lupashin's LabUniversity of Arkansas for Medical SciencesSee Customer Feedback tab for detailed information.)

Rabbit SEPT2 Polyclonal Antibody | anti-SEPT2 antibody

SEPT2 Antibody - N-terminal region

Gene Names
SEPT2; DIFF6; NEDD5; NEDD-5; Pnutl3; hNedd5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SEPT2; Polyclonal Antibody; SEPT2 Antibody - N-terminal region; anti-SEPT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK
Sequence Length
361
Applicable Applications for anti-SEPT2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SEPT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: Human Cervical Cancer, Mouse, Monkey FibroblastSample Type:1. Human Cervical Cancer Cell Lysate (15ug)2. Monkey Fibroblast Cell Lysate (15ug)Primary Dilution:1:1000Secondary Antibody: goat anti-RabbitSecondary Dilution:1:40,000Image Submitted by:Dr. Jakob Szwedo, Dr. Lupashin's LabUniversity of Arkansas for Medical SciencesSee Customer Feedback tab for detailed information.)

Western Blot (WB) (Sample Type: Human Cervical Cancer, Mouse, Monkey FibroblastSample Type:1. Human Cervical Cancer Cell Lysate (15ug)2. Monkey Fibroblast Cell Lysate (15ug)Primary Dilution:1:1000Secondary Antibody: goat anti-RabbitSecondary Dilution:1:40,000Image Submitted by:Dr. Jakob Szwedo, Dr. Lupashin's LabUniversity of Arkansas for Medical SciencesSee Customer Feedback tab for detailed information.)

Western Blot (WB)

(Host: RabbitTarget Name: SEPT2Sample Type: Human 293TAntibody Dilution: 1.0ug/mlSEPT2 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (Host: RabbitTarget Name: SEPT2Sample Type: Human 293TAntibody Dilution: 1.0ug/mlSEPT2 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB)

(Host: RabbitTarget Name: SEPT2Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlSEPT2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (Host: RabbitTarget Name: SEPT2Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlSEPT2 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB)

(Host: RabbitTarget Name: SEPT2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SEPT2Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-SEPT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate.SEPT2 is strongly supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-SEPT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate.SEPT2 is strongly supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-SEPT2 antibody
This is a rabbit polyclonal antibody against SEPT2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SEPT2 is required for normal progress through mitosis. SEPT2 is involved in cytokinesis.
Product Categories/Family for anti-SEPT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
septin-2 isoform a
NCBI Official Synonym Full Names
septin 2
NCBI Official Symbol
SEPT2
NCBI Official Synonym Symbols
DIFF6; NEDD5; NEDD-5; Pnutl3; hNedd5
NCBI Protein Information
septin-2
UniProt Protein Name
Septin-2
UniProt Gene Name
SEPT2
UniProt Synonym Gene Names
DIFF6; KIAA0158; NEDD5; NEDD-5
UniProt Entry Name
SEPT2_HUMAN

Uniprot Description

SEPT2: a member of the septin family of proteins. May be involved in the process of cytokinesis. Accumulates near the contractile ring from anaphase through telophase, and finally condenses into the midbody. In interphase and postmitotic cells, localized to fibrous or granular structures, depending on the growth state of the cell.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis; Cell development/differentiation; Cell cycle regulation; Hydrolase

Chromosomal Location of Human Ortholog: 2q37

Cellular Component: nucleoplasm; perinuclear region of cytoplasm; cytoplasm; nucleolus; exocyst; synapse; spindle; midbody; cell cortex; nucleus; actin cytoskeleton; cleavage furrow

Molecular Function: protein binding; GTP binding; protein complex scaffold; enzyme regulator activity

Biological Process: mitosis; smoothened signaling pathway; regulation of protein localization; cell division; regulation of catalytic activity; cilium biogenesis; regulation of L-glutamate transport; neurite development

Research Articles on SEPT2

Similar Products

Product Notes

The SEPT2 sept2 (Catalog #AAA3212910) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SEPT2 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's SEPT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SEPT2 sept2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSKQQPTQFI NPETPGYVGF ANLPNQVHRK SVKKGFEFTL MVVGESGLGK. It is sometimes possible for the material contained within the vial of "SEPT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.