Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type :Untransfected HEK293 and Sema3F-AP transfected HEK293 Primary Antibody Dilution :1:1000 Secondary Antibody :Anti rabbit-Alexa Fluor 488 Secondary Antibody Dilution :1:500 Color/Signal Descriptions :Gene Name :SEMA3FSubmitted by :Dr. Tracy Tran, Rutgers University )

Rabbit Sema3f Polyclonal Antibody | anti-SEMA3F antibody

Sema3f antibody - N-terminal region

Gene Names
Sema3f; Sema4; Semak
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Affinity Purified
Synonyms
Sema3f; Polyclonal Antibody; Sema3f antibody - N-terminal region; anti-SEMA3F antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH
Sequence Length
754
Applicable Applications for anti-SEMA3F antibody
Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type :Untransfected HEK293 and Sema3F-AP transfected HEK293 Primary Antibody Dilution :1:1000 Secondary Antibody :Anti rabbit-Alexa Fluor 488 Secondary Antibody Dilution :1:500 Color/Signal Descriptions :Gene Name :SEMA3FSubmitted by :Dr. Tracy Tran, Rutgers University )

Immunohistochemistry (IHC) (Sample Type :Untransfected HEK293 and Sema3F-AP transfected HEK293 Primary Antibody Dilution :1:1000 Secondary Antibody :Anti rabbit-Alexa Fluor 488 Secondary Antibody Dilution :1:500 Color/Signal Descriptions :Gene Name :SEMA3FSubmitted by :Dr. Tracy Tran, Rutgers University )

Immunoprecipitation (IP)

(Researcher: Dr. Chrisna LeVaillant, School of Anatomy and Human BiologyApplication: IPSpecies+tissue/cell type:1.5mL conditioned media from HEK293F cells transfected with 1: Sema 3F_AP, 2: Sema3C_DYKDDDDK, 3: UntransfectedAmount of IP Antibody: Amount of IP Antibody: 5ugPrimary antibody dilution: 1:1000Secondary antibody: Goat Anti-rabbit HRPSecondary antibody dilution:1:10000)

Immunoprecipitation (IP) (Researcher: Dr. Chrisna LeVaillant, School of Anatomy and Human BiologyApplication: IPSpecies+tissue/cell type:1.5mL conditioned media from HEK293F cells transfected with 1: Sema 3F_AP, 2: Sema3C_DYKDDDDK, 3: UntransfectedAmount of IP Antibody: Amount of IP Antibody: 5ugPrimary antibody dilution: 1:1000Secondary antibody: Goat Anti-rabbit HRPSecondary antibody dilution:1:10000)

Western Blot (WB)

(WB Suggested Anti-SEMA3F AntibodyPositive Control: Lane1: No transfection, Lane, 2: Cell lysates from HEK293 cells were transfected with alkaline phosphatase (AP-) tagged Sema3F, Lane3: AP-alone, Lane4: The cell media from cells transfected with AP-Sema3FPrimary Antibody Dilution : 1ug/mlSecondary Antibody : Anti-APSecondry Antibody Dilution : 1:1000Submitted by: Dr. Tracy Tran, Rutgers University)

Western Blot (WB) (WB Suggested Anti-SEMA3F AntibodyPositive Control: Lane1: No transfection, Lane, 2: Cell lysates from HEK293 cells were transfected with alkaline phosphatase (AP-) tagged Sema3F, Lane3: AP-alone, Lane4: The cell media from cells transfected with AP-Sema3FPrimary Antibody Dilution : 1ug/mlSecondary Antibody : Anti-APSecondry Antibody Dilution : 1:1000Submitted by: Dr. Tracy Tran, Rutgers University)

Western Blot (WB)

(WB Suggested Anti-Sema3f AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)

Western Blot (WB) (WB Suggested Anti-Sema3f AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)
Related Product Information for anti-SEMA3F antibody
This is a rabbit polyclonal antibody against Sema3f. It was validated on Western Blot

Target Description: The function remains unknown.
Product Categories/Family for anti-SEMA3F antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
semaphorin-3F isoform 2
NCBI Official Synonym Full Names
sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3F
NCBI Official Symbol
Sema3f
NCBI Official Synonym Symbols
Sema4; Semak
NCBI Protein Information
semaphorin-3F
UniProt Protein Name
Semaphorin-3F
Protein Family
UniProt Gene Name
Sema3f
UniProt Synonym Gene Names
Sema IV
UniProt Entry Name
SEM3F_MOUSE

Uniprot Description

SEMA3F: May play a role in cell motility and cell adhesion. Belongs to the semaphorin family.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted

Cellular Component: extracellular region; extracellular space

Molecular Function: chemorepellent activity; semaphorin receptor binding

Biological Process: axon extension involved in axon guidance; axon guidance; branchiomotor neuron axon guidance; facial nerve structural organization; negative chemotaxis; negative regulation of axon extension involved in axon guidance; nerve development; neural crest cell migration; positive regulation of cell migration; trigeminal nerve structural organization

Research Articles on SEMA3F

Similar Products

Product Notes

The SEMA3F sema3f (Catalog #AAA3212858) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Sema3f antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Sema3f can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB). Researchers should empirically determine the suitability of the SEMA3F sema3f for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FIHAELIPDS AERNDDKLYF FFRERSAEAP QNPAVYARIG RICLNDDGGH. It is sometimes possible for the material contained within the vial of "Sema3f, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.