Western Blot (WB)
(WB Suggested Anti-DAPP1 Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysateDAPP1 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Rabbit DAPP1 Polyclonal Antibody | anti-DAPP1 antibody
DAPP1 antibody - middle region
Gene Names
DAPP1; BAM32
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DAPP1; Polyclonal Antibody; DAPP1 antibody - middle region; anti-DAPP1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG
Sequence Length
280
Applicable Applications for anti-DAPP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DAPP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-DAPP1 Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysateDAPP1 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Western Blot (WB)
(WB Suggested Anti-DAPP1 Antibody Titration: 0.2-1 ug/mlPositive Control: OVCAR-3 cell lysateDAPP1 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Related Product Information for anti-DAPP1 antibody
This is a rabbit polyclonal antibody against DAPP1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: DAPP1 may act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.
Target Description: DAPP1 may act as a B-cell-associated adapter that regulates B-cell antigen receptor (BCR)-signaling downstream of PI3K.
Product Categories/Family for anti-DAPP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32
NCBI Official Full Name
dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide isoform 1
NCBI Official Synonym Full Names
dual adaptor of phosphotyrosine and 3-phosphoinositides 1
NCBI Official Symbol
DAPP1
NCBI Official Synonym Symbols
BAM32
NCBI Protein Information
dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide
UniProt Protein Name
Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide
UniProt Gene Name
DAPP1
UniProt Synonym Gene Names
BAM32; hDAPP1
UniProt Entry Name
DAPP1_HUMAN
Uniprot Description
DAPP1: an adaptor protein. Regulates antigen receptor signaling downstream of phosphatidylinositol 3-kinase.
Protein type: Adaptor/scaffold
Chromosomal Location of Human Ortholog: 4q25-q27
Cellular Component: plasma membrane; cytosol
Molecular Function: phosphatidylinositol-3,4,5-triphosphate binding; phospholipid binding; phosphatidylinositol-3,4-bisphosphate binding
Biological Process: signal transduction; protein amino acid dephosphorylation
Research Articles on DAPP1
Similar Products
Product Notes
The DAPP1 dapp1 (Catalog #AAA3212017) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DAPP1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DAPP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DAPP1 dapp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLSVRAKDSV KHFHVEYTGY SFKFGFNEFS SLKDFVKHFA NQPLIGSETG. It is sometimes possible for the material contained within the vial of "DAPP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
