Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Sample Type: Mouse brainAmount and Sample Type :500 ug mouse brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :KIF5CPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :KIF5CSubmitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Rabbit KIF5C Polyclonal Antibody | anti-KIF5C antibody

KIF5C antibody - N-terminal region

Gene Names
KIF5C; KINN; NKHC; NKHC2; CDCBM2; NKHC-2
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Immunoprecipitation, Western Blot
Purity
Affinity Purified
Synonyms
KIF5C; Polyclonal Antibody; KIF5C antibody - N-terminal region; anti-KIF5C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDR
Sequence Length
957
Applicable Applications for anti-KIF5C antibody
Immunoprecipitation (IP), Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KIF5C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunoprecipitation (IP)

(Sample Type: Mouse brainAmount and Sample Type :500 ug mouse brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :KIF5CPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :KIF5CSubmitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Immunoprecipitation (IP) (Sample Type: Mouse brainAmount and Sample Type :500 ug mouse brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :KIF5CPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :KIF5CSubmitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Western Blot (WB)

(Lanes:1. Mouse WT brain extract (80ug) 2. Rat brain extract (80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody:IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Gene Name:KIF5CSubmitted by:Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Western Blot (WB) (Lanes:1. Mouse WT brain extract (80ug) 2. Rat brain extract (80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody:IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Gene Name:KIF5CSubmitted by:Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Western Blot (WB)

(WB Suggested Anti-KIF5C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-KIF5C Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)
Related Product Information for anti-KIF5C antibody
This is a rabbit polyclonal antibody against KIF5C. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: KIF5C belongs to the kinesin-like protein family, Kinesin subfamily. It contains 1 kinesin-motor domain. Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport.
Product Categories/Family for anti-KIF5C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
109kDa
NCBI Official Full Name
kinesin heavy chain isoform 5C
NCBI Official Synonym Full Names
kinesin family member 5C
NCBI Official Symbol
KIF5C
NCBI Official Synonym Symbols
KINN; NKHC; NKHC2; CDCBM2; NKHC-2
NCBI Protein Information
kinesin heavy chain isoform 5C; kinesin heavy chain
UniProt Protein Name
Kinesin heavy chain isoform 5C
Protein Family
UniProt Gene Name
KIF5C
UniProt Synonym Gene Names
KIAA0531; NKHC2
UniProt Entry Name
KIF5C_HUMAN

NCBI Description

The protein encoded by this gene is a kinesin heavy chain subunit involved in the transport of cargo within the central nervous system. The encoded protein, which acts as a tetramer by associating with another heavy chain and two light chains, interacts with protein kinase CK2. Mutations in this gene have been associated with complex cortical dysplasia with other brain malformations-2. Two transcript variants, one protein-coding and the other non-protein coding, have been found for this gene. [provided by RefSeq, Jul 2015]

Research Articles on KIF5C

Similar Products

Product Notes

The KIF5C kif5c (Catalog #AAA3211831) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIF5C antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KIF5C can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP), Western Blot (WB). Researchers should empirically determine the suitability of the KIF5C kif5c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ADPAECSIKV MCRFRPLNEA EILRGDKFIP KFKGDETVVI GQGKPYVFDR. It is sometimes possible for the material contained within the vial of "KIF5C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.