Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-PDE1A antibodyFormalin Fixed Paraffin Embedded Tissue: Human KidneyPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Rabbit PDE1A Polyclonal Antibody | anti-PDE1A antibody

PDE1A antibody - C-terminal region

Gene Names
PDE1A; HCAM1; HCAM-1; HSPDE1A; CAM-PDE 1A; CAM-PDE-1A
Reactivity
Dog, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PDE1A; Polyclonal Antibody; PDE1A antibody - C-terminal region; anti-PDE1A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AVDLKSFKNNLVDIIQQNKERWKELAAQGESDLHKNSEDLVNAEEKHDET
Sequence Length
545
Applicable Applications for anti-PDE1A antibody
Western Blot (WB)
Homology
Dog: 93%; Human: 100%; Mouse: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PDE1A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-PDE1A antibodyFormalin Fixed Paraffin Embedded Tissue: Human KidneyPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC) (Rabbit Anti-PDE1A antibodyFormalin Fixed Paraffin Embedded Tissue: Human KidneyPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC)

(Rabbit Anti-PDE1A antibodyFormalin Fixed Paraffin Embedded Tissue: Human LiverPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC) (Rabbit Anti-PDE1A antibodyFormalin Fixed Paraffin Embedded Tissue: Human LiverPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC)

(Rabbit Anti-PDE1A antibodyFormalin Fixed Paraffin Embedded Tissue: Human ThyroidPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC) (Rabbit Anti-PDE1A antibodyFormalin Fixed Paraffin Embedded Tissue: Human ThyroidPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Western Blot (WB)

(WB Suggested Anti-PDE1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-PDE1A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-PDE1A antibody
This is a rabbit polyclonal antibody against PDE1A. It was validated on Western Blot

Target Description: PDE1A belongs to the cyclic nucleotide phosphodiesterase family. It has a higher affinity for cGMP than for cAMP. The exact function of PDE1A remains unknown.
Product Categories/Family for anti-PDE1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A isoform 1
NCBI Official Synonym Full Names
phosphodiesterase 1A
NCBI Official Symbol
PDE1A
NCBI Official Synonym Symbols
HCAM1; HCAM-1; HSPDE1A; CAM-PDE 1A; CAM-PDE-1A
NCBI Protein Information
calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A
UniProt Protein Name
Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A
UniProt Gene Name
PDE1A
UniProt Synonym Gene Names
Cam-PDE 1A
UniProt Entry Name
PDE1A_HUMAN

NCBI Description

Cyclic nucleotide phosphodiesterases (PDEs) play a role in signal transduction by regulating intracellular cyclic nucleotide concentrations through hydrolysis of cAMP and/or cGMP to their respective nucleoside 5-prime monophosphates. Members of the PDE1 family, such as PDE1A, are Ca(2+)/calmodulin (see CALM1; MIM 114180)-dependent PDEs (CaM-PDEs) that are activated by calmodulin in the presence of Ca(2+) (Michibata et al., 2001 [PubMed 11342109]; Fidock et al., 2002 [PubMed 11747989]).[supplied by OMIM, Oct 2009]

Uniprot Description

PDE1A: Cyclic nucleotide phosphodiesterase with a dual- specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a higher affinity for cGMP than for cAMP. Belongs to the cyclic nucleotide phosphodiesterase family. PDE1 subfamily. 9 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.4.17; Phosphodiesterase; Nucleotide Metabolism - purine

Chromosomal Location of Human Ortholog: 2q32.1

Cellular Component: cell soma; nucleus; cytosol

Molecular Function: calmodulin binding; 3',5'-cyclic-AMP phosphodiesterase activity; calmodulin-dependent cyclic-nucleotide phosphodiesterase activity; calcium- and calmodulin-regulated 3',5'-cyclic-GMP phosphodiesterase activity; metal ion binding; cGMP binding

Biological Process: epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; regulation of smooth muscle cell proliferation; nerve growth factor receptor signaling pathway; phospholipase C activation; cAMP catabolic process; innate immune response; cGMP catabolic process; signal transduction; blood coagulation

Research Articles on PDE1A

Similar Products

Product Notes

The PDE1A pde1a (Catalog #AAA3211413) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PDE1A antibody - C-terminal region reacts with Dog, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PDE1A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PDE1A pde1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AVDLKSFKNN LVDIIQQNKE RWKELAAQGE SDLHKNSEDL VNAEEKHDET. It is sometimes possible for the material contained within the vial of "PDE1A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.