Western Blot (WB)
(WB Suggested Anti-NANP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Rabbit NANP Polyclonal Antibody | anti-NANP antibody
NANP antibody - middle region
Gene Names
NANP; HDHD4; C20orf147; dJ694B14.3
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NANP; Polyclonal Antibody; NANP antibody - middle region; anti-NANP antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VQPGDCVMVGDTLETDIQGGLNAGLKATVWINKNGIVPLKSSPVPHYMVS
Sequence Length
248
Applicable Applications for anti-NANP antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NANP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-NANP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-NANP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-NANP antibody
This is a rabbit polyclonal antibody against NANP. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The specific function of this protein remains unknown.
Target Description: The specific function of this protein remains unknown.
Product Categories/Family for anti-NANP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
N-acylneuraminate-9-phosphatase
NCBI Official Synonym Full Names
N-acetylneuraminic acid phosphatase
NCBI Official Symbol
NANP
NCBI Official Synonym Symbols
HDHD4; C20orf147; dJ694B14.3
NCBI Protein Information
N-acylneuraminate-9-phosphatase
UniProt Protein Name
N-acylneuraminate-9-phosphatase
Protein Family
UniProt Gene Name
NANP
UniProt Synonym Gene Names
C20orf147; HDHD4
UniProt Entry Name
NANP_HUMAN
Uniprot Description
HDHD4: Belongs to the HAD-like hydrolase superfamily. NANP family.
Protein type: Carbohydrate Metabolism - amino sugar and nucleotide sugar; EC 3.1.3.29; Phosphatase (non-protein)
Chromosomal Location of Human Ortholog: 20p11.1
Cellular Component: cytosol
Molecular Function: N-acylneuraminate-9-phosphatase activity
Biological Process: N-acetylglucosamine biosynthetic process; N-acetylneuraminate biosynthetic process; cellular protein metabolic process; dephosphorylation; dolichol-linked oligosaccharide biosynthetic process; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification
Similar Products
Product Notes
The NANP nanp (Catalog #AAA3211126) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NANP antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NANP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NANP nanp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VQPGDCVMVG DTLETDIQGG LNAGLKATVW INKNGIVPLK SSPVPHYMVS. It is sometimes possible for the material contained within the vial of "NANP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
