Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-RDHE2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Transfected 293T)

Rabbit RDHE2 Polyclonal Antibody | anti-SDR16C5 antibody

RDHE2 antibody - middle region

Gene Names
SDR16C5; RDH#2; RDHE2; EPHD-2; RDH-E2; retSDR2
Reactivity
Guinea Pig, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RDHE2; Polyclonal Antibody; RDHE2 antibody - middle region; anti-SDR16C5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKT
Sequence Length
309
Applicable Applications for anti-SDR16C5 antibody
Western Blot (WB)
Homology
Guinea Pig: 92%; Human: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RDHE2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-RDHE2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-RDHE2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Transfected 293T)
Related Product Information for anti-SDR16C5 antibody
This is a rabbit polyclonal antibody against RDHE2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The specific function of RDHE2 is not yet known.RDHE2 belongs to a family of short-chain alcohol dehydrogenases/reductases that catalyze the first and rate-limiting step that generates retinaldehyde from retinol (Matsuzaka et al., 2002 [PubMed 12372410]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-454 AB083038.1 1-454 455-1307 AK095159.1 549-1401 1308-2860 BC037219.1 749-2301 2861-3039 BC037219.1 2303-2481
Product Categories/Family for anti-SDR16C5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
epidermal retinol dehydrogenase 2 isoform 2
NCBI Official Synonym Full Names
short chain dehydrogenase/reductase family 16C member 5
NCBI Official Symbol
SDR16C5
NCBI Official Synonym Symbols
RDH#2; RDHE2; EPHD-2; RDH-E2; retSDR2
NCBI Protein Information
epidermal retinol dehydrogenase 2
UniProt Protein Name
Epidermal retinol dehydrogenase 2
UniProt Gene Name
SDR16C5
UniProt Synonym Gene Names
RDHE2; EPHD-2; RDH-E2; retSDR2
UniProt Entry Name
RDHE2_HUMAN

NCBI Description

This gene encodes a member of the short-chain alcohol dehydrogenase/reductase superfamily of proteins and is involved in the oxidation of retinol to retinaldehyde. The encoded protein is associated with the endoplasmic reticulum and is predicted to contain three transmembrane helices, suggesting that it is an integral membrane protein. It recognizes all-trans-retinol and all-trans-retinaldehyde as substrates and exhibits a strong preference for NAD(+)/NADH as cofactors. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]

Uniprot Description

RDHE2: Oxidoreductase with strong preference for NAD. Active in both the oxidative and reductive directions. Oxidizes all-trans- retinol in all-trans-retinaldehyde. No activity was detected with 11-cis-retinol or 11-cis-retinaldehyde as substrates with either NAD(+)/NADH or NADP(+)/NADPH. Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Oxidoreductase; Membrane protein, integral; EC 1.1.1.105

Chromosomal Location of Human Ortholog: 8q12.1

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: retinol dehydrogenase activity

Biological Process: retinal metabolic process; retinol metabolic process; detection of light stimulus involved in visual perception; keratinocyte proliferation

Research Articles on SDR16C5

Similar Products

Product Notes

The SDR16C5 sdr16c5 (Catalog #AAA3210911) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RDHE2 antibody - middle region reacts with Guinea Pig, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RDHE2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SDR16C5 sdr16c5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AGLSGVNGLA DYCASKFAAF GFAESVFVET FVQKQKGIKT TIVCPFFIKT. It is sometimes possible for the material contained within the vial of "RDHE2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.