Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: RRAGBSample Type: COLO205 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit RRAGB Polyclonal Antibody | anti-RRAGB antibody

RRAGB Antibody - C-terminal region

Gene Names
RRAGB; RAGB; bA465E19.1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity purified
Synonyms
RRAGB; Polyclonal Antibody; RRAGB Antibody - C-terminal region; anti-RRAGB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKQCLLM
Sequence Length
346
Applicable Applications for anti-RRAGB antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human RRAGB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: RRAGBSample Type: COLO205 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: RRAGBSample Type: COLO205 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-RRAGB antibody
This is a rabbit polyclonal antibody against RRAGB. It was validated on Western Blot

Target Description: Ras-homologous GTPases constitute a large family of signal transducers that alternate between an activated, GTP-binding state and an inactivated, GDP-binding state. These proteins represent cellular switches that are operated by GTP-exchange factors and factors that stimulate their intrinsic GTPase activity. All GTPases of the Ras superfamily have in common the presence of six conserved motifs involved in GTP/GDP binding, three of which are phosphate-/magnesium-binding sites (PM1-PM3) and three of which are guanine nucleotide-binding sites (G1-G3). Transcript variants encoding distinct isoforms have been identified.
Product Categories/Family for anti-RRAGB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
ras-related GTP-binding protein B short isoform
NCBI Official Synonym Full Names
Ras related GTP binding B
NCBI Official Symbol
RRAGB
NCBI Official Synonym Symbols
RAGB; bA465E19.1
NCBI Protein Information
ras-related GTP-binding protein B
UniProt Protein Name
Ras-related GTP-binding protein B
UniProt Gene Name
RRAGB
UniProt Synonym Gene Names
Rag B; RagB
UniProt Entry Name
RRAGB_HUMAN

NCBI Description

Ras-homologous GTPases constitute a large family of signal transducers that alternate between an activated, GTP-binding state and an inactivated, GDP-binding state. These proteins represent cellular switches that are operated by GTP-exchange factors and factors that stimulate their intrinsic GTPase activity. All GTPases of the Ras superfamily have in common the presence of six conserved motifs involved in GTP/GDP binding, three of which are phosphate-/magnesium-binding sites (PM1-PM3) and three of which are guanine nucleotide-binding sites (G1-G3). Transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

RRAGB: Has guanine nucleotide-binding activity but undetectable intrinsic GTPase activity. Required for the amino acid-induced relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. This is a crucial step in the activation of the TOR signaling cascade by amino acids. Involved in the RCC1/Ran-GTPase pathway. Involved in the RCC1/Ran-GTPase pathway. The short isoform binds GTP. Interacts with RRAGC and RRAGD. Belongs to the GTR/RAG GTP-binding protein family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: Xp11.21

Cellular Component: Golgi apparatus; intracellular membrane-bound organelle; lysosomal membrane; lysosome; cytoplasm; nucleus

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding; guanyl ribonucleotide binding

Biological Process: metabolic process; regulation of autophagy; cellular response to starvation; positive regulation of TOR signaling pathway

Research Articles on RRAGB

Similar Products

Product Notes

The RRAGB rragb (Catalog #AAA3210753) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RRAGB Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RRAGB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RRAGB rragb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IDIFTSNTYV MVVMSDPSIP SAATLINIRN ARKHFEKLER VDGPKQCLLM. It is sometimes possible for the material contained within the vial of "RRAGB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.