Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Complexin 2 in human hippocampus was detected using HRP/AEC red color stain. )

Rabbit CPLX2 Polyclonal Antibody | anti-CPLX2 antibody

CPLX2 antibody - N-terminal region

Gene Names
CPLX2; CPX2; Hfb1; 921-L; CPX-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CPLX2; Polyclonal Antibody; CPLX2 antibody - N-terminal region; anti-CPLX2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKA
Sequence Length
134
Applicable Applications for anti-CPLX2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CPLX2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Complexin 2 in human hippocampus was detected using HRP/AEC red color stain. )

Immunohistochemistry (IHC) (Complexin 2 in human hippocampus was detected using HRP/AEC red color stain. )

Western Blot (WB)

(WB Suggested Anti-CPLX2 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-CPLX2 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)
Related Product Information for anti-CPLX2 antibody
This is a rabbit polyclonal antibody against CPLX2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15
NCBI Official Full Name
complexin-2
NCBI Official Synonym Full Names
complexin 2
NCBI Official Symbol
CPLX2
NCBI Official Synonym Symbols
CPX2; Hfb1; 921-L; CPX-2
NCBI Protein Information
complexin-2
UniProt Protein Name
Complexin-2
Protein Family
UniProt Gene Name
CPLX2
UniProt Synonym Gene Names
CPX II
UniProt Entry Name
CPLX2_HUMAN

NCBI Description

Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CPLX2: Negatively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. Positively regulates a late step in synaptic vesicle exocytosis. Also involved in mast cell exocytosis. Belongs to the complexin/synaphin family.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 5q35.2

Cellular Component: mast cell granule; cell soma; dendrite; synapse; cytosol

Molecular Function: syntaxin-1 binding; calcium-dependent protein binding

Biological Process: regulation of exocytosis; nervous system development; synaptic vesicle exocytosis; positive regulation of synaptic plasticity; mast cell degranulation; cell differentiation; vesicle docking during exocytosis

Research Articles on CPLX2

Similar Products

Product Notes

The CPLX2 cplx2 (Catalog #AAA3210676) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CPLX2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CPLX2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CPLX2 cplx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDFVMKQALG GATKDMGKML GGEEEKDPDA QKKEEERQEA LRQQEEERKA. It is sometimes possible for the material contained within the vial of "CPLX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.