Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CHCHD4Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit CHCHD4 Polyclonal Antibody | anti-CHCHD4 antibody

CHCHD4 Antibody - C-terminal region

Gene Names
CHCHD4; MIA40; TIMM40
Reactivity
Dog; Guinea Pig; Human; Mouse; Rat; Yeast; Zebrafish
Applications
Western Blot
Purity
Affinity purified
Synonyms
CHCHD4; Polyclonal Antibody; CHCHD4 Antibody - C-terminal region; anti-CHCHD4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog; Guinea Pig; Human; Mouse; Rat; Yeast; Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FRAMQECMQKYPDLYPQEDEDEEEEREKKPAEQAEETAPIEATATKEEEGS
Sequence Length
15
Applicable Applications for anti-CHCHD4 antibody
Western Blot (WB)
Homology
Dog: 79%; Guinea Pig: 91%; Human: 100%; Mouse: 85%; Rat: 85%; Yeast: 90%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CHCHD4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CHCHD4Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CHCHD4Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CHCHD4 antibody
coiled-coil-helix-coiled-coil-helix domain containing 4

Target Description: CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus.
Product Categories/Family for anti-CHCHD4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
142
NCBI Official Full Name
mitochondrial intermembrane space import and assembly protein 40 isoform 1
NCBI Official Synonym Full Names
coiled-coil-helix-coiled-coil-helix domain containing 4
NCBI Official Symbol
CHCHD4
NCBI Official Synonym Symbols
MIA40; TIMM40
NCBI Protein Information
mitochondrial intermembrane space import and assembly protein 40
UniProt Protein Name
Mitochondrial intermembrane space import and assembly protein 40
UniProt Gene Name
CHCHD4
UniProt Synonym Gene Names
MIA40
UniProt Entry Name
MIA40_HUMAN

NCBI Description

CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus (Hofmann et al., 2005 [PubMed 16185709]).[supplied by OMIM, Mar 2008]

Uniprot Description

CHCHD4: Required for the import and folding of small cysteine- containing proteins (small Tim) in the mitochondrial intermembrane space (IMS). Probably acts by forming a redox cycle with GFER/ERV1 that involves a disulfide relay system. Precursor proteins to be imported into the IMS are translocated in their reduced form into the mitochondria. The oxidized form of MIA40 forms a transient intermolecular disulfide bridge with the reduced precursor protein, resulting in oxidation of the precursor protein that now contains an intramolecular disulfide bond and is able to undergo folding in the IMS (Probable). 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial

Chromosomal Location of Human Ortholog: 3p25.1

Cellular Component: mitochondrion; mitochondrial intermembrane space

Molecular Function: protein disulfide oxidoreductase activity

Biological Process: 'de novo' posttranslational protein folding; protein maturation via protein folding; cellular protein metabolic process; protein import into mitochondrial intermembrane space; protein targeting to mitochondrion

Research Articles on CHCHD4

Similar Products

Product Notes

The CHCHD4 chchd4 (Catalog #AAA3210496) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHCHD4 Antibody - C-terminal region reacts with Dog; Guinea Pig; Human; Mouse; Rat; Yeast; Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CHCHD4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHCHD4 chchd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FRAMQECMQK YPDLYPQEDE DEEEEREKKP AEQAEETAPI EATATKEEEG S. It is sometimes possible for the material contained within the vial of "CHCHD4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.