Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Wasf2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)

Rabbit Wasf2 Polyclonal Antibody | anti-WASF2 antibody

Wasf2 antibody - middle region

Gene Names
Wasf2; WAVE2; AW742646; D4Ertd13e
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Wasf2; Polyclonal Antibody; Wasf2 antibody - middle region; anti-WASF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QNGSIGSVENVDAASYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPADN
Sequence Length
497
Applicable Applications for anti-WASF2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 79%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Wasf2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)

Western Blot (WB) (WB Suggested Anti-Wasf2 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Thymus)
Related Product Information for anti-WASF2 antibody
This is a rabbit polyclonal antibody against Wasf2. It was validated on Western Blot

Target Description: Wasf2 is a downstream effector molecule involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. It promotes formation of actin filaments. Wasf2 is a part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex.
Product Categories/Family for anti-WASF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
wiskott-Aldrich syndrome protein family member 2
NCBI Official Synonym Full Names
WAS protein family, member 2
NCBI Official Symbol
Wasf2
NCBI Official Synonym Symbols
WAVE2; AW742646; D4Ertd13e
NCBI Protein Information
wiskott-Aldrich syndrome protein family member 2
UniProt Protein Name
Wiskott-Aldrich syndrome protein family member 2
UniProt Gene Name
Wasf2
UniProt Synonym Gene Names
WASP family protein member 2

Uniprot Description

WAVE2: Downstream effector molecule involved in the transmission of signals from tyrosine kinase receptors and small GTPases to the actin cytoskeleton. Promotes formation of actin filaments. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. Binds actin and the Arp2/3 complex. Interacts with BAIAP2. Component of the WAVE2 complex composed of ABI1, CYFIP1/SRA1, NCKAP1/NAP1 and WASF2/WAVE2. Directly interacts with BRK1. Expressed in all tissues with strongest expression in placenta, lung, and peripheral blood leukocytes, but not in skeletal muscle. Belongs to the SCAR/WAVE family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Actin-binding; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 4 D2.3|4 66.22 cM

Cellular Component: cell projection; cytoplasm; cytoskeleton; early endosome; extracellular exosome; intercellular junction; intracellular; lamellipodium; protein complex; ruffle

Molecular Function: actin binding; cadherin binding; protein binding; protein complex binding; protein kinase A binding; SH3 domain binding

Biological Process: actin cytoskeleton organization; actin filament-based movement; ameboidal cell migration; angiogenesis; cell motility; endocytosis; lamellipodium assembly; lamellipodium morphogenesis; negative regulation of stress fiber formation; positive regulation of lamellipodium assembly; Rac protein signal transduction

Research Articles on WASF2

Similar Products

Product Notes

The WASF2 wasf2 (Catalog #AAA3210311) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Wasf2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Wasf2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the WASF2 wasf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QNGSIGSVEN VDAASYPPPP QSDSASSPSP SFSEDNLPPP PAEFSYPADN. It is sometimes possible for the material contained within the vial of "Wasf2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.