Rabbit SENP6 Polyclonal Antibody | anti-SENP6 antibody

SENP6 antibody - C-terminal region

Cat. Num. AAA3210003

• Gene Names: SENP6; SSP1; SUSP1
• Reactivity: Cow, Horse, Human, Pig
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: SENP6; Polyclonal Antibody; SENP6 antibody - C-terminal region; anti-SENP6 antibody

• Host: Rabbit
• Reactivity: Cow, Horse, Human, Pig
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MNLANWFPPPRMRTKREEIRNIILKLQEDQSKEKRKHKDTYSTEAPLGEG
• Sequence Length: 1105

• Applicable Applications for anti-SENP6 antibody: Western Blot (WB)
• Homology: Cow: 79%; Horse: 79%; Human: 100%; Pig: 91%
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SENP6
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: RatSample Type: 1.Rat Testis cells (200ug) Primary Dilution: 1:1000Secondary Antibody: alkaline phosphatase-conjugated anti-rabbitSecondary Dilution: 1:1000Image Submitted by: Andreia CarvalhoIBMC-OBF, Portugal See Customer Feedback tab for detailed information.)

Western Blot (WB)

(WB Suggested Anti-SENP6 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysateSENP6 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Related Product Information for anti-SENP6 antibody

This is a rabbit polyclonal antibody against SENP6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SENP6 is a UBL-specific protease that deconjugates SUMO1, SUMO2 and SUMO3 from targeted proteins. It does not seem to be involved in the processing of full-length SUMO proteins to their mature forms. SENP6 deconjugates SUMO1 from RXRA, leading to transcriptional activation. It may act preferentially on substrates containing 3 or more SUMO2 or SUMO3 moieties.Ubiquitin-like molecules (UBLs), such as SUMO1 (UBL1; MIM 601912), are structurally related to ubiquitin (MIM 191339) and can be ligated to target proteins in a similar manner as ubiquitin. However, covalent attachment of UBLs does not result in degradation of the modified proteins. SUMO1 modification is implicated in the targeting of RANGAP1 (MIM 602362) to the nuclear pore complex, as well as in stabilization of I-kappa-B-alpha (NFKBIA; MIM 164008) from degradation by the 26S proteasome. Like ubiquitin, UBLs are synthesized as precursor proteins, with 1 or more amino acids following the C-terminal glycine-glycine residues of the mature UBL protein. Thus, the tail sequences of the UBL precursors need to be removed by UBL-specific proteases, such as SENP6, prior to their conjugation to target proteins (Kim et al., 2000 [PubMed 10799485]).[supplied by OMIM].

Product Categories/Family for anti-SENP6 antibody

Polyclonal; Chromatin & Nuclear Signaling; E3 & Ubiquitin; Sumoylation

NCBI and Uniprot Product Information

• NCBI GI #: 156105703
• NCBI GeneID: 26054
• NCBI Accession #: NP_001093879
• NCBI GenBank Nucleotide #: NM_001100409
• UniProt Accession #: Q9GZR1
• Molecular Weight: 125kDa
• NCBI Official Full Name: sentrin-specific protease 6 isoform 2
• NCBI Official Synonym Full Names: SUMO specific peptidase 6
• NCBI Official Symbol: SENP6
• NCBI Official Synonym Symbols: SSP1; SUSP1
• NCBI Protein Information: sentrin-specific protease 6
• UniProt Protein Name: Sentrin-specific protease 6
• Protein Family: Sentrin-specific protease
• UniProt Gene Name: SENP6
• UniProt Synonym Gene Names: KIAA0797; SSP1; SUSP1
• UniProt Entry Name: SENP6_HUMAN

NCBI Description

Ubiquitin-like molecules (UBLs), such as SUMO1 (UBL1; MIM 601912), are structurally related to ubiquitin (MIM 191339) and can be ligated to target proteins in a similar manner as ubiquitin. However, covalent attachment of UBLs does not result in degradation of the modified proteins. SUMO1 modification is implicated in the targeting of RANGAP1 (MIM 602362) to the nuclear pore complex, as well as in stabilization of I-kappa-B-alpha (NFKBIA; MIM 164008) from degradation by the 26S proteasome. Like ubiquitin, UBLs are synthesized as precursor proteins, with 1 or more amino acids following the C-terminal glycine-glycine residues of the mature UBL protein. Thus, the tail sequences of the UBL precursors need to be removed by UBL-specific proteases, such as SENP6, prior to their conjugation to target proteins (Kim et al., 2000 [PubMed 10799485]). SENPs also display isopeptidase activity for deconjugation of SUMO-conjugated substrates (Lima and Reverter, 2008 [PubMed 18799455]).[supplied by OMIM, Jun 2009]

Uniprot Description

SENP6: Protease that deconjugates SUMO1, SUMO2 and SUMO3 from targeted proteins. Processes preferentially poly-SUMO2 and poly- SUMO3 chains, but does not efficiently process SUMO1, SUMO2 and SUMO3 precursors. Deconjugates SUMO1 from RXRA, leading to transcriptional activation. Involved in chromosome alignment and spindle assembly, by regulating the kinetochore CENPH-CENPI-CENPK complex. Desumoylates PML and CENPI, protecting them from degradation by the ubiquitin ligase RNF4, which targets polysumoylated proteins for proteasomal degradation. Desumoylates also RPA1, thus preventing recruitment of RAD51 to the DNA damage foci to initiate DNA repair through homologous recombination. Belongs to the peptidase C48 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; EC 3.4.22.68

Chromosomal Location of Human Ortholog: 6q14.1

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: protein binding; SUMO-specific protease activity

Biological Process: protein desumoylation; protein sumoylation; proteolysis