Western Blot (WB)
(Host: RabbitTarget Name: THSD1Sample Type: A549 Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit THSD1 Polyclonal Antibody | anti-THSD1 antibody
THSD1 Antibody - middle region
Gene Names
THSD1; TMTSP; UNQ3010
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
THSD1; Polyclonal Antibody; THSD1 Antibody - middle region; anti-THSD1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AQGQWVEFGCAPLGPEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVM
Sequence Length
429
Applicable Applications for anti-THSD1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human THSD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: THSD1Sample Type: A549 Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: THSD1Sample Type: A549 Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-THSD1 antibody
This is a rabbit polyclonal antibody against THSD1. It was validated on Western Blot
Target Description: The protein encoded by this gene contains a type 1 thrombospondin domain, which is found in a number of proteins involved in the complement pathway, as well as in extracellular matrix proteins. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene.
Target Description: The protein encoded by this gene contains a type 1 thrombospondin domain, which is found in a number of proteins involved in the complement pathway, as well as in extracellular matrix proteins. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene.
Product Categories/Family for anti-THSD1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
thrombospondin type-1 domain-containing protein 1 isoform 1
NCBI Official Synonym Full Names
thrombospondin type 1 domain containing 1
NCBI Official Symbol
THSD1
NCBI Official Synonym Symbols
TMTSP; UNQ3010
NCBI Protein Information
thrombospondin type-1 domain-containing protein 1
UniProt Protein Name
Thrombospondin type-1 domain-containing protein 1
Protein Family
UniProt Gene Name
THSD1
UniProt Synonym Gene Names
TMTSP
UniProt Entry Name
THSD1_HUMAN
NCBI Description
The protein encoded by this gene contains a type 1 thrombospondin domain, which is found in a number of proteins involved in the complement pathway, as well as in extracellular matrix proteins. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq, Jan 2009]
Uniprot Description
THSD1: contains a type 1 thrombospondin domain, which is found in a number of proteins involved in the complement pathway, as well as in extracellular matrix proteins. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq, Jan 2009]
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 13q14.3
Cellular Component: cell surface; cytoplasm; extracellular region; integral to membrane
Biological Process: hemopoietic progenitor cell differentiation
Research Articles on THSD1
Similar Products
Product Notes
The THSD1 thsd1 (Catalog #AAA3209414) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The THSD1 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's THSD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the THSD1 thsd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AQGQWVEFGC APLGPEAYVT VVLKLLGRDS VITSTGPIDL AQKFGYKLVM. It is sometimes possible for the material contained within the vial of "THSD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
