Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: STRABSample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human STRADB Polyclonal Antibody | anti-STRADB antibody

STRADB Antibody - C-terminal region

Gene Names
STRADB; PAPK; ILPIP; ILPIPA; ALS2CR2; CALS-21; PRO1038
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
STRADB; Polyclonal Antibody; STRADB Antibody - C-terminal region; anti-STRADB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GTHTVNSDRLHTPSSKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFK
Sequence Length
377
Applicable Applications for anti-STRADB antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human STRAB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: STRABSample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: STRABSample Type: Fetal Liver lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-STRADB antibody
This is a rabbit polyclonal antibody against STRAB. It was validated on Western Blot

Target Description: This gene encodes a protein that belongs to the serine/threonine protein kinase STE20 subfamily. One of the active site residues in the protein kinase domain of this protein is altered, and it is thus a pseudokinase. This protein is a component of a complex involved in the activation of serine/threonine kinase 11, a master kinase that regulates cell polarity and energy-generating metabolism. This complex regulates the relocation of this kinase from the nucleus to the cytoplasm, and it is essential for G1 cell cycle arrest mediated by this kinase. The protein encoded by this gene can also interact with the X chromosome-linked inhibitor of apoptosis protein, and this interaction enhances the anti-apoptotic activity of this protein via the JNK1 signal transduction pathway. Two pseudogenes, located on chromosomes 1 and 7, have been found for this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-STRADB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
STE20-related kinase adapter protein beta isoform 1
NCBI Official Synonym Full Names
STE20 related adaptor beta
NCBI Official Symbol
STRADB
NCBI Official Synonym Symbols
PAPK; ILPIP; ILPIPA; ALS2CR2; CALS-21; PRO1038
NCBI Protein Information
STE20-related kinase adapter protein beta
UniProt Protein Name
STE20-related kinase adapter protein beta
UniProt Gene Name
STRADB
UniProt Synonym Gene Names
ALS2CR2; ILPIP; STRAD beta
UniProt Entry Name
STRAB_HUMAN

NCBI Description

This gene encodes a protein that belongs to the serine/threonine protein kinase STE20 subfamily. One of the active site residues in the protein kinase domain of this protein is altered, and it is thus a pseudokinase. This protein is a component of a complex involved in the activation of serine/threonine kinase 11, a master kinase that regulates cell polarity and energy-generating metabolism. This complex regulates the relocation of this kinase from the nucleus to the cytoplasm, and it is essential for G1 cell cycle arrest mediated by this kinase. The protein encoded by this gene can also interact with the X chromosome-linked inhibitor of apoptosis protein, and this interaction enhances the anti-apoptotic activity of this protein via the JNK1 signal transduction pathway. Two pseudogenes, located on chromosomes 1 and 7, have been found for this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]

Uniprot Description

STLK6: Pseudokinase which, in complex with CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta), binds to and activates STK11/LKB1. Adopts a closed conformation typical of active protein kinases and binds STK11/LKB1 as a pseudosubstrate, promoting conformational change of STK11/LKB1 in an active conformation. Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, protein; Motility/polarity/chemotaxis; Protein kinase, STE; Protein kinase, Ser/Thr (non-receptor); STE group; STE20 family; STLK subfamily

Chromosomal Location of Human Ortholog: 2q33.1

Cellular Component: cytoplasm; cytosol; nucleus

Molecular Function: protein binding; ATP binding; protein kinase activity; receptor signaling protein serine/threonine kinase activity

Biological Process: cell morphogenesis; activation of protein kinase activity; insulin receptor signaling pathway; JNK cascade; protein export from nucleus; mitotic cell cycle; cell cycle arrest; protein amino acid phosphorylation

Research Articles on STRADB

Similar Products

Product Notes

The STRADB stradb (Catalog #AAA3209376) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The STRADB Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STRADB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STRADB stradb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GTHTVNSDRL HTPSSKTFSP AFFSLVQLCL QQDPEKRPSA SSLLSHVFFK. It is sometimes possible for the material contained within the vial of "STRADB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.