Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CHST6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)

Rabbit CHST6 Polyclonal Antibody | anti-CHST6 antibody

CHST6 antibody - middle region

Gene Names
CHST6; MCDC1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CHST6; Polyclonal Antibody; CHST6 antibody - middle region; anti-CHST6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QELCAGALQLLGYRPVYSEDEQRNLALDLVLPRGLNGFTWASSTASHPRN
Sequence Length
395
Applicable Applications for anti-CHST6 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 83%; Guinea Pig: 82%; Horse: 86%; Human: 100%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CHST6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CHST6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)

Western Blot (WB) (WB Suggested Anti-CHST6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysate)
Related Product Information for anti-CHST6 antibody
This is a rabbit polyclonal antibody against CHST6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CHST6 catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues of keratan. It mediates sulfation of keratan in cornea. Keratan sulfate plays a central role in maintaining corneal transparency. CHST6 acts on the non-reducing terminal GlcNAc of short and long carbohydrate substrates that have poly-N-acetyllactosamine structures.
Product Categories/Family for anti-CHST6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
carbohydrate sulfotransferase 6
NCBI Official Synonym Full Names
carbohydrate sulfotransferase 6
NCBI Official Symbol
CHST6
NCBI Official Synonym Symbols
MCDC1
NCBI Protein Information
carbohydrate sulfotransferase 6
UniProt Protein Name
Carbohydrate sulfotransferase 6
UniProt Gene Name
CHST6
UniProt Synonym Gene Names
C-GlcNAc6ST; hCGn6ST; GST4-beta; GlcNAc6ST-5; Gn6st-5
UniProt Entry Name
CHST6_HUMAN

NCBI Description

The protein encoded by this gene is an enzyme that catalyzes the transfer of a sulfate group to the GlcNAc residues of keratan. Keratan sulfate helps maintain corneal transparency. Defects in this gene are a cause of macular corneal dystrophy (MCD). [provided by RefSeq, Jan 2010]

Uniprot Description

CHST6: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues of keratan. Mediates sulfation of keratan in cornea. Keratan sulfate plays a central role in maintaining corneal transparency. Acts on the non-reducing terminal GlcNAc of short and long carbohydrate substrates that have poly-N- acetyllactosamine structures. Defects in CHST6 are the cause of macular corneal dystrophy (MCD). MCD is an autosomal recessive disease characterized by corneal opacities. Onset occurs in the first decade, usually between ages 5 and 9. The disorder is progressive. Minute, gray, punctate opacities develop. Corneal sensitivity is usually reduced. Painful attacks with photophobia, foreign body sensations, and recurrent erosions occur in most patients. There are different types of MCD: MCD type I, in which there is a virtual absence of sulfated keratan sulfate (KS) in the serum and cornea, as determined by KS-specific antibodies; and MCD type II, in which the normal sulfated KS-antibody response is present in cornea and serum. MCD type I patients usually have a homozygous missense mutation, while MCD type II patients show a large deletion and replacement in the upstream region of CHST6. The only missense mutation for type II is Cys-50, which is heterozygous with a replacement in the upstream region on the other allele of CHST6. Belongs to the sulfotransferase 1 family. Gal/GlcNAc/GalNAc subfamily.

Protein type: Transferase; Membrane protein, integral; Glycan Metabolism - keratan sulfate biosynthesis; EC 2.8.2.-

Chromosomal Location of Human Ortholog: 16q22

Cellular Component: Golgi membrane; Golgi apparatus; integral to membrane

Molecular Function: N-acetylglucosamine 6-O-sulfotransferase activity

Biological Process: keratan sulfate metabolic process; sulfur metabolic process; glycosaminoglycan metabolic process; keratan sulfate biosynthetic process; carbohydrate metabolic process; N-acetylglucosamine metabolic process; pathogenesis

Disease: Macular Dystrophy, Corneal, 1

Research Articles on CHST6

Similar Products

Product Notes

The CHST6 chst6 (Catalog #AAA3209214) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHST6 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CHST6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHST6 chst6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QELCAGALQL LGYRPVYSED EQRNLALDLV LPRGLNGFTW ASSTASHPRN. It is sometimes possible for the material contained within the vial of "CHST6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.