Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CRYAB Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Rabbit CRYAB Polyclonal Antibody | anti-CRYAB antibody

CRYAB antibody - C-terminal region

Gene Names
CRYAB; MFM2; CRYA2; CTPP2; HSPB5; CMD1II; CTRCT16; HEL-S-101
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Protein A purified
Synonyms
CRYAB; Polyclonal Antibody; CRYAB antibody - C-terminal region; anti-CRYAB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVT
Sequence Length
175
Applicable Applications for anti-CRYAB antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Sheep: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CRYAB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CRYAB Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-CRYAB Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-CRYAB antibody
This is a rabbit polyclonal antibody against CRYAB. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Alpha crystallins are composed of: alpha-A and alpha-B, for acidic and basic, respectively. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates. Post-translational modifications decrease the ability to chaperone. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. Alpha-A and alpha-B are differentially expressed; alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Elevated expression of alpha-B crystallin occurs in many neurological diseases; a missense mutation cosegregated in a family with a desmin-related myopathy.
Product Categories/Family for anti-CRYAB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
crystallin, alpha B, isoform CRA_c
NCBI Official Synonym Full Names
crystallin alpha B
NCBI Official Symbol
CRYAB
NCBI Official Synonym Symbols
MFM2; CRYA2; CTPP2; HSPB5; CMD1II; CTRCT16; HEL-S-101
NCBI Protein Information
alpha-crystallin B chain
UniProt Protein Name
Alpha-crystallin B chain
Protein Family
UniProt Gene Name
CRYAB
UniProt Synonym Gene Names
CRYA2; HspB5
UniProt Entry Name
CRYAB_HUMAN

NCBI Description

Mammalian lens crystallins are divided into alpha, beta, and gamma families. Alpha crystallins are composed of two gene products: alpha-A and alpha-B, for acidic and basic, respectively. Alpha crystallins can be induced by heat shock and are members of the small heat shock protein (HSP20) family. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates. These heterogeneous aggregates consist of 30-40 subunits; the alpha-A and alpha-B subunits have a 3:1 ratio, respectively. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Alpha-A and alpha-B gene products are differentially expressed; alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Elevated expression of alpha-B crystallin occurs in many neurological diseases; a missense mutation cosegregated in a family with a desmin-related myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2019]

Uniprot Description

CRYAB: a major structural protein of the eye lens. A member of the small heat shock protein (sHSP also known as the HSP20) family. Alpha-B is expressed in the lens as well as other tissues. Elevated expression of alpha-B crystallin occurs in many neurological diseases; a missense mutation cosegregated in a family with a desmin-related myopathy.

Protein type: Heat shock protein; Chaperone

Chromosomal Location of Human Ortholog: 11q22.3-q23.1

Cellular Component: microtubule cytoskeleton; Golgi apparatus; cell surface; mitochondrion; cytoplasm; plasma membrane; actin filament bundle; nucleus; cytosol; Z disc

Molecular Function: identical protein binding; protein binding; protein homodimerization activity; microtubule binding; metal ion binding; unfolded protein binding; structural constituent of eye lens

Biological Process: lens development in camera-type eye; muscle development; protein folding; stress-activated MAPK cascade; microtubule polymerization or depolymerization; negative regulation of caspase activity; response to estradiol stimulus; tubulin folding; negative regulation of intracellular transport; response to hydrogen peroxide; muscle contraction; response to hypoxia; negative regulation of cell growth; protein homooligomerization; aging; negative regulation of apoptosis

Disease: Cataract 16, Multiple Types; Myopathy, Myofibrillar, Fatal Infantile Hypertonic, Alpha-b Crystallin-related; Myopathy, Myofibrillar, 2; Cardiomyopathy, Dilated, 1ii

Research Articles on CRYAB

Similar Products

Product Notes

The CRYAB cryab (Catalog #AAA3208914) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRYAB antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CRYAB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CRYAB cryab for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KYRIPADVDP LTITSSLSSD GVLTVNGPRK QVSGPERTIP ITREEKPAVT. It is sometimes possible for the material contained within the vial of "CRYAB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.