Western Blot (WB)
(WB Suggested Anti-eve Antibody Titration: 0.2-1 ug/mlPositive Control: Drosophila)
Rabbit eve Polyclonal Antibody | anti-EVE antibody
eve antibody - N-terminal region
Gene Names
eve; 10.5; 10.9; 14.10; 20.35; CG2328; dm-eve; DmelCG2328; E(eve); Eve; EVE; eve2; even; F; l(2)46Ce; l(2)46CFg; l(2)46CFh; l(2)46CFj; l(2)46CFp; l(2)46Cg; V; VI
Applications
Western Blot
Purity
Affinity Purified
Synonyms
eve; Polyclonal Antibody; eve antibody - N-terminal region; anti-EVE antibody
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQTPPPSPNECLS
Sequence Length
376
Applicable Applications for anti-EVE antibody
Western Blot (WB)
Homology
Fruit fly: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Fruit fly
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-eve Antibody Titration: 0.2-1 ug/mlPositive Control: Drosophila)
Western Blot (WB)
(WB Suggested Anti-eve Antibody Titration: 0.2-1 ug/mlPositive Control: Drosophila)
Related Product Information for anti-EVE antibody
This is a rabbit polyclonal antibody against eve. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Eve may play a role in determining neuronal identity. It may be directly involved in specifying identity of individual neurons. It is a pair-rule protein required for segmentation; involved in transforming the broad, spatial, aperiodic expression patterns of the gap genes into a system of precise periodic expression patterns of the pair-rule and segmentary polarity genes.
Target Description: Eve may play a role in determining neuronal identity. It may be directly involved in specifying identity of individual neurons. It is a pair-rule protein required for segmentation; involved in transforming the broad, spatial, aperiodic expression patterns of the gap genes into a system of precise periodic expression patterns of the pair-rule and segmentary polarity genes.
Product Categories/Family for anti-EVE antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
even skipped
NCBI Official Synonym Full Names
even skipped
NCBI Official Symbol
eve
NCBI Official Synonym Symbols
10.5; 10.9; 14.10; 20.35; CG2328; dm-eve; DmelCG2328; E(eve); Eve; EVE; eve2; even; F; l(2)46Ce; l(2)46CFg; l(2)46CFh; l(2)46CFj; l(2)46CFp; l(2)46Cg; V; VI
NCBI Protein Information
even skipped
UniProt Protein Name
Segmentation protein even-skipped
Protein Family
UniProt Gene Name
eve
Uniprot Description
May play a role in determining neuronal identity. May be directly involved in specifying identity of individual neurons. Pair-rule protein required for segmentation; involved in transforming the broad, spatial, aperiodic expression patterns of the gap genes into a system of precise periodic expression patterns of the pair-rule and segmentary polarity genes.
Research Articles on EVE
Similar Products
Product Notes
The EVE eve (Catalog #AAA3208779) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's eve can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EVE eve for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MHGYRTYNME SHHAHHDASP VDQKPLVVDL LATQYGKPQT PPPSPNECLS. It is sometimes possible for the material contained within the vial of "eve, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
