Western Blot (WB)
(exd antibody - C-terminal region validated by WB using Drosophila EXD constructs at 1:1000.)
Rabbit exd Polyclonal Antibody | anti-EXD antibody
exd antibody - C-terminal region
Gene Names
exd; anon-EST:fe1H3; CG8933; DExd; Dm-EXD; DmelCG8933; Dpbx; Exd; EXD; l(1)IV; lincRNA.S9404; Pbx1; td48
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
exd; Polyclonal Antibody; exd antibody - C-terminal region; anti-EXD antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGA
Sequence Length
376
Applicable Applications for anti-EXD antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Fruit fly
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(exd antibody - C-terminal region validated by WB using Drosophila EXD constructs at 1:1000.)
Western Blot (WB)
(exd antibody - C-terminal region validated by WB using Drosophila EXD constructs at 1:1000.)
Western Blot (WB)
(Lanes:Lane1: E. coli purified Exd (no tag)Lane2: Cell free expressed Exd (His tag)Primary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:exdSubmitted by:Kimberly Kaufman, Univeristy of Wisconsin-Madison)
Western Blot (WB)
(Lanes:Lane1: E. coli purified Exd (no tag)Lane2: Cell free expressed Exd (His tag)Primary Antibody Dilution:1:1000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:5000Gene Name:exdSubmitted by:Kimberly Kaufman, Univeristy of Wisconsin-Madison)
Western Blot (WB)
(WB Suggested Anti-exd Antibody Titration: 5.0ug/mlPositive Control: Drosophila)
Western Blot (WB)
(WB Suggested Anti-exd Antibody Titration: 5.0ug/mlPositive Control: Drosophila)
Related Product Information for anti-EXD antibody
This is a rabbit polyclonal antibody against exd. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: As a transcription factor, exd acts with the selector homeodomain proteins altering the regulation of downstream target genes such as wingless, teashirt and decapentaplegic. Thus exd affects segmental identity.
Target Description: As a transcription factor, exd acts with the selector homeodomain proteins altering the regulation of downstream target genes such as wingless, teashirt and decapentaplegic. Thus exd affects segmental identity.
Product Categories/Family for anti-EXD antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Synonym Full Names
extradenticle
NCBI Official Symbol
exd
NCBI Official Synonym Symbols
anon-EST:fe1H3; CG8933; DExd; Dm-EXD; DmelCG8933; Dpbx; Exd; EXD; l(1)IV; lincRNA.S9404; Pbx1; td48
NCBI Protein Information
extradenticle
UniProt Protein Name
Homeobox protein extradenticle
Protein Family
UniProt Gene Name
exd
UniProt Synonym Gene Names
Dpbx
Uniprot Description
Transcription factor which acts with the selector homeodomain proteins altering the regulation of downstream target genes such as wingless (wg), teashirt (tsh) and decapentaplegic (dpp), thus affecting segmental identity. Delimits the eye field and prevent inappropriate eye development. Required for proper localization of chordotonal organs within the peripheral nervous system.
Research Articles on EXD
Similar Products
Product Notes
The EXD exd (Catalog #AAA3208784) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The exd antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's exd can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EXD exd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EAKEELARKC GITVSQVSNW FGNKRIRYKK NIGKAQEEAN LYAAKKAAGA. It is sometimes possible for the material contained within the vial of "exd, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
