Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FBP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Rabbit FBP2 Polyclonal Antibody | anti-FBP2 antibody

FBP2 antibody - middle region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FBP2; Polyclonal Antibody; FBP2 antibody - middle region; anti-FBP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YAKYFDAATTEYVQKKKFPEDGSAPYGARYVGSMVADVHRTLVYGGIFLY
Sequence Length
339
Applicable Applications for anti-FBP2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FBP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FBP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-FBP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Related Product Information for anti-FBP2 antibody
This is a rabbit polyclonal antibody against FBP2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FBP2 is a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate.This gene encodes a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate.
Product Categories/Family for anti-FBP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
fructose-1,6-bisphosphatase isozyme 2
NCBI Official Synonym Full Names
fructose-bisphosphatase 2
NCBI Official Symbol
FBP2
NCBI Protein Information
fructose-1,6-bisphosphatase isozyme 2
UniProt Protein Name
Fructose-1,6-bisphosphatase isozyme 2
Protein Family
UniProt Gene Name
FBP2
UniProt Synonym Gene Names
FBPase 2
UniProt Entry Name
F16P2_HUMAN

NCBI Description

This gene encodes a gluconeogenesis regulatory enzyme which catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. [provided by RefSeq, Jul 2008]

Uniprot Description

FBPase 2: a key enzyme of gluconeogenesis that catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate, a precursor to glucose 6-phosphate. A regulator of glucose synthesis from non-carbohydrates. Two paralogs of this enzyme exists in humans: FBP1 is expressed in the liver and gluconeogenic tissues, and FBP2 in striated muscle. FBP2 is only isozyme expressed in striated muscle and it is widely expressed in cells that are nongluconeogenic. Both forms are inhibited allosterically by AMP, NAD and Ca2+. The muscle form is about 100-fold more sensitive to AMP and NAD, and about 1000-fold more sensitive to inhibition by Ca2+, the major activator of glycolysis in striated muscle. Forms an active complex with aldolase that binds to the sarcomeric Z-line, which is disrupted by elevated calcium levels, blocking glycogen synthesis during exercise. Forms homotetramers that are stabilized in the active state by divalent cations (Mg2+, Mn2+ , Co+2, or Zn2+). Its interaction with aldolase appears to desensitizes it to inhibition by AMP and, partially, by Ca2+. Up to 50% of lactate generated in striated muscle is converted to glycogen.

Protein type: Carbohydrate Metabolism - fructose and mannose; Carbohydrate Metabolism - pentose phosphate pathway; Carbohydrate Metabolism - glycolysis and gluconeogenesis; EC 3.1.3.11; Phosphatase (non-protein)

Chromosomal Location of Human Ortholog: 9q22.3

Cellular Component: Z disc; nucleus; cell junction; cytosol

Molecular Function: metal ion binding; fructose-bisphosphatase activity

Biological Process: dephosphorylation; carbohydrate metabolic process; glucose metabolic process; pathogenesis; fructose metabolic process; gluconeogenesis

Research Articles on FBP2

Similar Products

Product Notes

The FBP2 fbp2 (Catalog #AAA3208771) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FBP2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FBP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FBP2 fbp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YAKYFDAATT EYVQKKKFPE DGSAPYGARY VGSMVADVHR TLVYGGIFLY. It is sometimes possible for the material contained within the vial of "FBP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.