Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-AGPAT5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

Rabbit AGPAT5 Polyclonal Antibody | anti-AGPAT5 antibody

AGPAT5 antibody - N-terminal region

Gene Names
AGPAT5; LPAATE; 1AGPAT5
Reactivity
Cow, Human, Pig, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AGPAT5; Polyclonal Antibody; AGPAT5 antibody - N-terminal region; anti-AGPAT5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Pig, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RLLSAFLPARFYQALDDRLYCVYQSMVLFFFENYTGVQILLYGDLPKNKE
Sequence Length
364
Applicable Applications for anti-AGPAT5 antibody
Western Blot (WB)
Homology
Cow: 86%; Human: 100%; Pig: 86%; Rat: 79%; Yeast: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human AGPAT5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-AGPAT5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-AGPAT5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)
Related Product Information for anti-AGPAT5 antibody
This is a rabbit polyclonal antibody against AGPAT5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Mitochondrial creatine kinase (MtCK) is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Sarcomeric mitochondrial creatine kinase has 80% homology with the coding exons of ubiquitous mitochondrial creatine kinase. This gene contains sequences homologous to several motifs that are shared among some nuclear genes encoding mitochondrial proteins and thus may be essential for the coordinated activation of these genes during mitochondrial biogenesis. Three transcript variants encoding the same protein have been found for this gene.This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
NCBI Official Synonym Full Names
1-acylglycerol-3-phosphate O-acyltransferase 5
NCBI Official Symbol
AGPAT5
NCBI Official Synonym Symbols
LPAATE; 1AGPAT5
NCBI Protein Information
1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
UniProt Protein Name
1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
UniProt Gene Name
AGPAT5
UniProt Synonym Gene Names
1-AGP acyltransferase 5; 1-AGPAT 5
UniProt Entry Name
PLCE_HUMAN

NCBI Description

This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. A pseudogene of this gene is present on the Y chromosome. [provided by RefSeq, Aug 2014]

Uniprot Description

AGPAT5: Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family.

Protein type: Membrane protein, integral; EC 2.3.1.51; Transferase; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 8p23.1

Cellular Component: mitochondrial outer membrane; endoplasmic reticulum membrane; mitochondrion; integral to membrane; nuclear envelope

Molecular Function: 1-acylglycerol-3-phosphate O-acyltransferase activity

Biological Process: phospholipid metabolic process; glycerophospholipid biosynthetic process; phosphatidic acid biosynthetic process; triacylglycerol biosynthetic process; hemopoietic progenitor cell differentiation; cellular lipid metabolic process; CDP-diacylglycerol biosynthetic process; phospholipid biosynthetic process

Research Articles on AGPAT5

Similar Products

Product Notes

The AGPAT5 agpat5 (Catalog #AAA3208570) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AGPAT5 antibody - N-terminal region reacts with Cow, Human, Pig, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's AGPAT5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AGPAT5 agpat5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RLLSAFLPAR FYQALDDRLY CVYQSMVLFF FENYTGVQIL LYGDLPKNKE. It is sometimes possible for the material contained within the vial of "AGPAT5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.