Western Blot (WB)
(Host: RabbitTarget Name: TMEM132ASample Type: THP-1 Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit TMEM132A Polyclonal Antibody | anti-TMEM132A antibody
TMEM132A Antibody - N-terminal region
Gene Names
TMEM132A; GBP; HSPA5BP1
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMEM132A; Polyclonal Antibody; TMEM132A Antibody - N-terminal region; anti-TMEM132A antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSGAVIISPSYASSVDCGQAPLDPVYLPAALELLDAPEHFRVQQVGHYPP
Sequence Length
412
Applicable Applications for anti-TMEM132A antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human TMEM132A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: TMEM132ASample Type: THP-1 Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: TMEM132ASample Type: THP-1 Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-TMEM132A antibody
This is a rabbit polyclonal antibody against TMEM132A. It was validated on Western Blot
Target Description: This gene encodes a protein that is highly similar to the rat Grp78-binding protein (GBP). Alternatively spliced transcript variants encoding different isoforms have been described.
Target Description: This gene encodes a protein that is highly similar to the rat Grp78-binding protein (GBP). Alternatively spliced transcript variants encoding different isoforms have been described.
Product Categories/Family for anti-TMEM132A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
transmembrane protein 132A isoform a
NCBI Official Synonym Full Names
transmembrane protein 132A
NCBI Official Symbol
TMEM132A
NCBI Official Synonym Symbols
GBP; HSPA5BP1
NCBI Protein Information
transmembrane protein 132A
UniProt Protein Name
Transmembrane protein 132A
Protein Family
UniProt Gene Name
TMEM132A
UniProt Synonym Gene Names
HSPA5BP1; KIAA1583
NCBI Description
This gene encodes a protein that is highly similar to the rat Grp78-binding protein (GBP). Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Uniprot Description
May play a role in embryonic and postnatal development of the brain. Increased resistance to cell death induced by serum starvation in cultured cells. Regulates cAMP-induced GFAP gene expression via STAT3 phosphorylation ().
Research Articles on TMEM132A
Similar Products
Product Notes
The TMEM132A tmem132a (Catalog #AAA3208533) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMEM132A Antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMEM132A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMEM132A tmem132a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSGAVIISPS YASSVDCGQA PLDPVYLPAA LELLDAPEHF RVQQVGHYPP. It is sometimes possible for the material contained within the vial of "TMEM132A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
