Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ARMCX3 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Spleen)

Rabbit ARMCX3 Polyclonal Antibody | anti-ARMCX3 antibody

ARMCX3 antibody - middle region

Gene Names
ARMCX3; ALEX3; GASP6; dJ545K15.2
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ARMCX3; Polyclonal Antibody; ARMCX3 antibody - middle region; anti-ARMCX3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE
Sequence Length
379
Applicable Applications for anti-ARMCX3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ARMCX3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ARMCX3 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Spleen)

Western Blot (WB) (WB Suggested Anti-ARMCX3 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Spleen)
Related Product Information for anti-ARMCX3 antibody
This is a rabbit polyclonal antibody against ARMCX3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-ARMCX3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
armadillo repeat-containing X-linked protein 3
NCBI Official Synonym Full Names
armadillo repeat containing X-linked 3
NCBI Official Symbol
ARMCX3
NCBI Official Synonym Symbols
ALEX3; GASP6; dJ545K15.2
NCBI Protein Information
armadillo repeat-containing X-linked protein 3
UniProt Protein Name
Armadillo repeat-containing X-linked protein 3
UniProt Gene Name
ARMCX3
UniProt Synonym Gene Names
ALEX3; Protein ALEX3
UniProt Entry Name
ARMX3_HUMAN

NCBI Description

This gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members on the X chromosome. Three transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ARMCX3: an armadillo-repeat protein. Armadillo proteins function in multiple processes including intracellular signalling, cytoskeletal regulation, and transcriptional regulation. Armadillo proteins include beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumour suppressor protein, and the nuclear transport factor importin-alpha.

Protein type: Membrane protein, integral; Mitochondrial

Chromosomal Location of Human Ortholog: Xq22.1

Cellular Component: integral to mitochondrial outer membrane

Biological Process: positive regulation of transcription from RNA polymerase II promoter

Research Articles on ARMCX3

Similar Products

Product Notes

The ARMCX3 armcx3 (Catalog #AAA3208506) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARMCX3 antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ARMCX3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ARMCX3 armcx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LFSAGNEETK LQVLKLLLNL AENPAMTREL LRAQVPSSLG SLFNKKENKE. It is sometimes possible for the material contained within the vial of "ARMCX3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.