Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Muscle )

Rabbit NPTN Polyclonal Antibody | anti-NPTN antibody

NPTN antibody - middle region

Gene Names
NPTN; GP55; GP65; SDR1; np55; np65; SDFR1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
NPTN; Polyclonal Antibody; NPTN antibody - middle region; anti-NPTN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN
Sequence Length
398
Applicable Applications for anti-NPTN antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NPTN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Muscle )

Immunohistochemistry (IHC) (Human Muscle )

Western Blot (WB)

(WB Suggested Anti-NPTN Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-NPTN Antibody Titration: 5.0ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-NPTN antibody
This is a rabbit polyclonal antibody against NPTN. It was validated on Western Blot and immunohistochemistry

Target Description: Neuroplastin is a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. The alpha and beta transcripts show differential localization within the brain.Neuroplastin is a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. The alpha and beta transcripts show differential localization within the brain.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
neuroplastin isoform b
NCBI Official Synonym Full Names
neuroplastin
NCBI Official Symbol
NPTN
NCBI Official Synonym Symbols
GP55; GP65; SDR1; np55; np65; SDFR1
NCBI Protein Information
neuroplastin
UniProt Protein Name
Neuroplastin
Protein Family
UniProt Gene Name
NPTN
UniProt Synonym Gene Names
SDFR1; SDR1; SDR-1
UniProt Entry Name
NPTN_HUMAN

NCBI Description

This gene encodes a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2009]

Uniprot Description

neuroplastin: Probable homophilic and heterophilic cell adhesion molecule involved in long term potentiation at hippocampal excitatory synapses through activation of p38MAPK. May also regulate neurite outgrowth by activating the FGFR1 signaling pathway. May play a role in synaptic plasticity. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cell development/differentiation

Chromosomal Location of Human Ortholog: 15q22

Cellular Component: presynaptic membrane; cell surface; integral to membrane

Molecular Function: cell adhesion molecule binding; transmembrane receptor protein tyrosine kinase activity; ATP binding; type 1 fibroblast growth factor receptor binding

Biological Process: elevation of cytosolic calcium ion concentration; peptidyl-tyrosine phosphorylation; positive regulation of fibroblast growth factor receptor signaling pathway; positive regulation of protein amino acid phosphorylation; homophilic cell adhesion; positive regulation of long-term neuronal synaptic plasticity; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on NPTN

Similar Products

Product Notes

The NPTN nptn (Catalog #AAA3208380) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NPTN antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NPTN can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the NPTN nptn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEYRINKPRA EDSGEYHCVY HFVSAPKANA TIEVKAAPDI TGHKRSENKN. It is sometimes possible for the material contained within the vial of "NPTN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.