Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Bmp2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Rat Heart)

Rabbit Bmp2 Polyclonal Antibody | anti-BMP2 antibody

Bmp2 antibody - middle region

Reactivity
Dog, Horse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Bmp2; Polyclonal Antibody; Bmp2 antibody - middle region; anti-BMP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEKPGVSKRHVRISRSLHQDEHSWSQVRPLLVTFGHDGKGHPLHKREKRQ
Sequence Length
393
Applicable Applications for anti-BMP2 antibody
Western Blot (WB)
Homology
Dog: 100%; Horse: 100%; Pig: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Bmp2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Rat Heart)

Western Blot (WB) (WB Suggested Anti-Bmp2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Rat Heart)
Related Product Information for anti-BMP2 antibody
This is a rabbit polyclonal antibody against Bmp2. It was validated on Western Blot

Target Description: Bmp2 induces cartilage and bone formation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
bone morphogenetic protein 2
NCBI Official Synonym Full Names
bone morphogenetic protein 2
NCBI Official Symbol
Bmp2
NCBI Protein Information
bone morphogenetic protein 2
UniProt Protein Name
Bone morphogenetic protein 2
UniProt Gene Name
Bmp2
UniProt Synonym Gene Names
Bmp-2; BMP-2; BMP-2A
UniProt Entry Name
BMP2_RAT

NCBI Description

involved in cellular signaling during limb development; induces bone formation [RGD, Feb 2006]

Uniprot Description

BMP2: Induces cartilage and bone formation. Belongs to the TGF-beta family.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted

Cellular Component: extracellular space; protein complex; cell surface; cytoplasm; extracellular region

Molecular Function: protein domain specific binding; protein homodimerization activity; growth factor activity; protein heterodimerization activity; phosphatase activator activity; cytokine activity; SMAD binding; transforming growth factor beta receptor binding; receptor binding; retinol dehydrogenase activity

Biological Process: activation of MAPK activity; positive regulation of apoptosis; heart development; positive regulation of transcription, DNA-dependent; adrenocorticotropin hormone secreting cell differentiation; telencephalon regionalization; protein amino acid phosphorylation; cardiac muscle cell differentiation; regulation of apoptosis; BMP signaling pathway; ovulation cycle; chondrocyte differentiation; inner ear development; regulation of odontogenesis of dentine-containing teeth; positive regulation of astrocyte differentiation; pericardium development; positive regulation of neurogenesis; cell fate commitment; organ morphogenesis; mesenchymal cell differentiation; response to mechanical stimulus; regulation of MAPKKK cascade; positive regulation of osteoblast proliferation; positive regulation of fat cell differentiation; positive regulation of endothelial cell proliferation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; positive regulation of cell differentiation; negative regulation of calcium-independent cell-cell adhesion; positive regulation of odontogenesis; proteoglycan metabolic process; embryonic heart tube anterior/posterior pattern formation; negative regulation of insulin-like growth factor receptor signaling pathway; thyroid stimulating hormone secreting cell differentiation; negative regulation of transcription from RNA polymerase II promoter; bone mineralization; negative regulation of cell cycle; negative regulation of cell proliferation; regulation of transcription, DNA-dependent; positive regulation of MAPKKK cascade; negative regulation of aldosterone biosynthetic process; cardiac muscle morphogensis; inflammatory response; positive regulation of Wnt receptor signaling pathway; cardiac cell differentiation; Notch signaling pathway; ossification; response to retinoic acid; protein destabilization; in utero embryonic development; positive regulation of bone mineralization; positive regulation of ossification; odontogenesis of dentine-containing teeth; osteoblast differentiation; positive regulation of osteoblast differentiation; telencephalon development; ureteric bud branching; cartilage development; response to hypoxia; epithelial to mesenchymal transition; positive regulation of protein amino acid phosphorylation; positive regulation of neuron differentiation; growth; positive regulation of cell migration

Research Articles on BMP2

Similar Products

Product Notes

The BMP2 bmp2 (Catalog #AAA3207649) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Bmp2 antibody - middle region reacts with Dog, Horse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Bmp2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BMP2 bmp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEKPGVSKRH VRISRSLHQD EHSWSQVRPL LVTFGHDGKG HPLHKREKRQ. It is sometimes possible for the material contained within the vial of "Bmp2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.