Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry with Human Pancrease lysate tissue at an antibody concentration of 5.0ug/ml using anti-SLC39A5 antibody )

Rabbit SLC39A5 Polyclonal Antibody | anti-SLC39A5 antibody

SLC39A5 antibody - N-terminal region

Gene Names
SLC39A5; ZIP5; MYP24; LZT-Hs7
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
SLC39A5; Polyclonal Antibody; SLC39A5 antibody - N-terminal region; anti-SLC39A5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HYLAQLFGLYGENGTLTAGGLARLLHSLGLGRVQGLRLGQHGPLTGRAAS
Sequence Length
539
Applicable Applications for anti-SLC39A5 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC39A5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with Human Pancrease lysate tissue at an antibody concentration of 5.0ug/ml using anti-SLC39A5 antibody )

Immunohistochemistry (IHC) (Immunohistochemistry with Human Pancrease lysate tissue at an antibody concentration of 5.0ug/ml using anti-SLC39A5 antibody )

Western Blot (WB)

(WB Suggested Anti-SLC39A5 Antibody Titration: 1 ug/mlPositive Control: Placenta)

Western Blot (WB) (WB Suggested Anti-SLC39A5 Antibody Titration: 1 ug/mlPositive Control: Placenta)
Related Product Information for anti-SLC39A5 antibody
This is a rabbit polyclonal antibody against SLC39A5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A5 belongs to a subfamily of proteins that show structural characteristics of zinc transporters.Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A5 belongs to a subfamily of proteins that show structural characteristics of zinc transporters (Taylor and Nicholson, 2003 [PubMed 12659941]).[supplied by OMIM].

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
zinc transporter ZIP5
NCBI Official Synonym Full Names
solute carrier family 39 member 5
NCBI Official Symbol
SLC39A5
NCBI Official Synonym Symbols
ZIP5; MYP24; LZT-Hs7
NCBI Protein Information
zinc transporter ZIP5
UniProt Protein Name
Zinc transporter ZIP5
Protein Family
UniProt Gene Name
SLC39A5
UniProt Synonym Gene Names
ZIP5; ZIP-5
UniProt Entry Name
S39A5_HUMAN

NCBI Description

The protein encoded by this gene belongs to the ZIP family of zinc transporters that transport zinc into cells from outside, and play a crucial role in controlling intracellular zinc levels. Zinc is an essential cofactor for many enzymes and proteins involved in gene transcription, growth, development and differentiation. Mutations in this gene have been associated with autosomal dominant high myopia (MYP24). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2014]

Uniprot Description

SLC39A5: May play a role in polarized cells by carrying out serosal-to-mucosal zinc transport. Seems to play a central role in controlling organismal zinc status. Belongs to the ZIP transporter (TC 2.A.5) family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Transporter, SLC family; Transporter

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: basolateral plasma membrane; integral to membrane

Molecular Function: metal ion transmembrane transporter activity

Biological Process: positive regulation of nuclear mRNA splicing, via spliceosome; BMP signaling pathway; eye development; zinc ion transport; transmembrane transport

Disease: Myopia 24, Autosomal Dominant

Research Articles on SLC39A5

Similar Products

Product Notes

The SLC39A5 slc39a5 (Catalog #AAA3207229) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC39A5 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SLC39A5 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SLC39A5 slc39a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HYLAQLFGLY GENGTLTAGG LARLLHSLGL GRVQGLRLGQ HGPLTGRAAS. It is sometimes possible for the material contained within the vial of "SLC39A5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.