Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SLC29A3Sample Tissue: Human Uterus Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SLC29A3 Polyclonal Antibody | anti-SLC29A3 antibody

SLC29A3 Antibody - C-terminal region

Gene Names
SLC29A3; ENT3; HJCD; PHID; HCLAP
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SLC29A3; Polyclonal Antibody; SLC29A3 Antibody - C-terminal region; anti-SLC29A3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KALPGFVLLRTCLIPLFVLCNYQPRVHLKTVVFQSDVYPALLSSLLGLSN
Sequence Length
329
Applicable Applications for anti-SLC29A3 antibody
Western Blot (WB)
Homology
Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SLC29A3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SLC29A3Sample Tissue: Human Uterus Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SLC29A3Sample Tissue: Human Uterus Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SLC29A3 antibody
solute carrier family 29 (nucleoside transporters), member 3

Target Description: This gene encodes a nucleoside transporter. The encoded protein plays a role in cellular uptake of nucleosides, nucleobases, and their related analogs. Mutations in this gene have been associated with H syndrome, which is characterized by cutaneous hyperpigmentation and hypertrichosis, hepatosplenomegaly, heart anomalies, and hypogonadism. A related disorder, PHID (pigmented hypertrichosis with insulin-dependent diabetes mellitus), has also been associated with mutations at this locus. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-SLC29A3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36 kDa
NCBI Official Full Name
equilibrative nucleoside transporter 3 isoform X2
NCBI Official Synonym Full Names
solute carrier family 29 member 3
NCBI Official Symbol
SLC29A3
NCBI Official Synonym Symbols
ENT3; HJCD; PHID; HCLAP
NCBI Protein Information
equilibrative nucleoside transporter 3
UniProt Protein Name
Equilibrative nucleoside transporter 3
UniProt Gene Name
SLC29A3
UniProt Synonym Gene Names
ENT3; hENT3
UniProt Entry Name
S29A3_HUMAN

NCBI Description

This gene encodes a nucleoside transporter. The encoded protein plays a role in cellular uptake of nucleosides, nucleobases, and their related analogs. Mutations in this gene have been associated with H syndrome, which is characterized by cutaneous hyperpigmentation and hypertrichosis, hepatosplenomegaly, heart anomalies, and hypogonadism. A related disorder, PHID (pigmented hypertrichosis with insulin-dependent diabetes mellitus), has also been associated with mutations at this locus. Alternatively spliced transcript variants have been described.[provided by RefSeq, Mar 2010]

Uniprot Description

SLC29A3: Mediates both influx and efflux of nucleosides across the membrane (equilibrative transporter). Mediates transport of adenine, adenosine and uridine, as well as several nucleoside analog drugs, such as anticancer and antiviral agents, including cladribine, cordycepin, tubercidin and AZT. Does not transport hypoxanthine. Defects in SLC29A3 are the cause of histiocytosis- lymphadenopathy plus syndrome (HLAS). A syndrome characterized by the combination of features from 2 or more of four histiocytic disorders, originally thought to be distinct: Faisalabad histiocytosis (FHC), sinus histiocytosis with massive lymphadenopathy (SHML), H syndrome, and pigmented hypertrichosis with insulin-dependent diabetes mellitus syndrome (PHID). FHC features include joint deformities, sensorineural hearing loss, and subsequent development of generalized lymphadenopathy and swellings in the eyelids that contain histiocytes. SHML causes lymph node enlargement in children frequently accompanied by fever, leukocytosis, elevated erythrocyte sedimentation rate, and polyclonal hypergammaglobulinemia. H syndrome is characterized by cutaneous hyperpigmentation and hypertrichosis, hepatosplenomegaly, heart anomalies, and hypogonadism; hearing loss is found in about half of patients. PHID is characterized by predominantly antibody-negative insulin-dependent diabetes mellitus associated with pigmented hypertrichosis and variable occurrence of other features of H syndrome. Belongs to the SLC29A/ENT transporter (TC 2.A.57) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter; Transporter, SLC family; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 10q22.1

Cellular Component: late endosome membrane; lysosomal membrane; integral to membrane

Molecular Function: nucleoside transmembrane transporter activity

Biological Process: transmembrane transport

Disease: Histiocytosis-lymphadenopathy Plus Syndrome

Research Articles on SLC29A3

Similar Products

Product Notes

The SLC29A3 slc29a3 (Catalog #AAA3207143) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC29A3 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC29A3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC29A3 slc29a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KALPGFVLLR TCLIPLFVLC NYQPRVHLKT VVFQSDVYPA LLSSLLGLSN. It is sometimes possible for the material contained within the vial of "SLC29A3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.