Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit DLG3 Polyclonal Antibody | anti-DLG3 antibody

DLG3 antibody - middle region

Gene Names
DLG3; MRX; XLMR; MRX90; NEDLG; SAP102; PPP1R82
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DLG3; Polyclonal Antibody; DLG3 antibody - middle region; anti-DLG3 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQF
Sequence Length
817
Applicable Applications for anti-DLG3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DLG3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DLG3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 293T cell lysateDLG3 is supported by BioGPS gene expression data to be expressed in HEK293T)

Related Product Information for anti-DLG3 antibody
This is a rabbit polyclonal antibody against DLG3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DLG3 is required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling. Defects in DLG3 are the cause of mental retardation X-linked type 90 (MRX90).
Product Categories/Family for anti-DLG3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90kDa
NCBI Official Full Name
disks large homolog 3 isoform a
NCBI Official Synonym Full Names
discs large MAGUK scaffold protein 3
NCBI Official Symbol
DLG3
NCBI Official Synonym Symbols
MRX; XLMR; MRX90; NEDLG; SAP102; PPP1R82
NCBI Protein Information
disks large homolog 3
UniProt Protein Name
Disks large homolog 3
Protein Family
UniProt Gene Name
DLG3
UniProt Synonym Gene Names
KIAA1232; SAP-102; SAP102

NCBI Description

This gene encodes a member of the membrane-associated guanylate kinase protein family. The encoded protein may play a role in clustering of NMDA receptors at excitatory synapses. It may also negatively regulate cell proliferation through interaction with the C-terminal region of the adenomatosis polyposis coli tumor suppressor protein. Mutations in this gene have been associated with X-linked cognitive disability. Alternatively spliced transcript variants have been described. [provided by RefSeq, Oct 2009]

Uniprot Description

Required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling.

Research Articles on DLG3

Similar Products

Product Notes

The DLG3 dlg3 (Catalog #AAA3206998) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DLG3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DLG3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DLG3 dlg3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FPHKFGSCVP HTTRPRRDNE VDGQDYHFVV SREQMEKDIQ DNKFIEAGQF. It is sometimes possible for the material contained within the vial of "DLG3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual