Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-ITGB1BP2 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit ITGB1BP2 Polyclonal Antibody | anti-ITGB1BP2 antibody

ITGB1BP2 antibody - N-terminal region

Gene Names
ITGB1BP2; CHORDC3; ITGB1BP; MELUSIN; MSTP015
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
ITGB1BP2; Polyclonal Antibody; ITGB1BP2 antibody - N-terminal region; anti-ITGB1BP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDF
Sequence Length
347
Applicable Applications for anti-ITGB1BP2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ITGB1BP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-ITGB1BP2 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-ITGB1BP2 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(WB Suggested Anti-ITGB1BP2 Antibody Titration: 2.5ug/mlPositive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-ITGB1BP2 Antibody Titration: 2.5ug/mlPositive Control: Human heart)
Related Product Information for anti-ITGB1BP2 antibody
This is a rabbit polyclonal antibody against ITGB1BP2. It was validated on Western Blot and immunohistochemistry

Target Description: ITGB1BP2 may play a role during maturation and/or organization of muscles cells.
Product Categories/Family for anti-ITGB1BP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
integrin beta-1-binding protein 2 isoform 1
NCBI Official Synonym Full Names
integrin subunit beta 1 binding protein 2
NCBI Official Symbol
ITGB1BP2
NCBI Official Synonym Symbols
CHORDC3; ITGB1BP; MELUSIN; MSTP015
NCBI Protein Information
integrin beta-1-binding protein 2
UniProt Protein Name
Integrin beta-1-binding protein 2
UniProt Gene Name
ITGB1BP2
UniProt Entry Name
ITBP2_HUMAN

NCBI Description

This gene encodes a protein with two cysteine and histidine-rich (CHORD) domains, PXXP motifs, YXXI/P motifs, putative SH2 and SH3 domain binding motifs, and an acidic region at the C-terminus that can bind calcium. Two hybrid analysis showed that this protein interacts with the cytoplasmic domain of the beta 1 integrin subunit and is thought to act as a chaperone protein. Studies in the mouse ortholog of this gene indicate that absence of this gene in mouse results in failed cardiac hypertrophy in response to mechanical stress. Alternative splicing results in multiple transcript variants encoding different isoforms, including an isoform that lacks several domains, including one of the CHORD domains. [provided by RefSeq, May 2017]

Uniprot Description

ITGB1BP2: May play a role during maturation and/or organization of muscles cells.

Chromosomal Location of Human Ortholog: Xq12-q13.1

Cellular Component: Z disc

Molecular Function: integrin binding; protein binding; zinc ion binding; calcium ion binding; SH3 domain binding

Biological Process: muscle development; signal transduction

Research Articles on ITGB1BP2

Similar Products

Product Notes

The ITGB1BP2 itgb1bp2 (Catalog #AAA3206331) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITGB1BP2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ITGB1BP2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ITGB1BP2 itgb1bp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSLLCRNKGC GQHFDPNTNL PDSCCHHPGV PIFHDALKGW SCCRKRTVDF. It is sometimes possible for the material contained within the vial of "ITGB1BP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.