Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type :Human lung adenocarcinoma cell line A549Primary Antibody Dilution :1:100Secondary Antibody :Goat anti-rabbit AlexaFluor 488Secondary Antibody Dilution :1:400Color/Signal Descriptions :MAK: Green DAPI:BlueGene Name :MAK Submitted by :Dr. Crissy Dudgeon, Ph.D., CINJ)

Rabbit MAK Polyclonal Antibody | anti-MAK antibody

MAK antibody - C-terminal region

Gene Names
MAK; RP62
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
MAK; Polyclonal Antibody; MAK antibody - C-terminal region; anti-MAK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WNTKTGRGQFSGRTYNPTAKNLNIVNRAQPIPSVHGRTDWVAKYGGHR
Sequence Length
623
Applicable Applications for anti-MAK antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MAK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type :Human lung adenocarcinoma cell line A549Primary Antibody Dilution :1:100Secondary Antibody :Goat anti-rabbit AlexaFluor 488Secondary Antibody Dilution :1:400Color/Signal Descriptions :MAK: Green DAPI:BlueGene Name :MAK Submitted by :Dr. Crissy Dudgeon, Ph.D., CINJ)

Immunohistochemistry (IHC) (Sample Type :Human lung adenocarcinoma cell line A549Primary Antibody Dilution :1:100Secondary Antibody :Goat anti-rabbit AlexaFluor 488Secondary Antibody Dilution :1:400Color/Signal Descriptions :MAK: Green DAPI:BlueGene Name :MAK Submitted by :Dr. Crissy Dudgeon, Ph.D., CINJ)

Western Blot (WB)

(Lanes:1. 30 ug MiaPaca-2 cell lysate2. 30 ug Panc-1 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-Rabbit HRPSecondary Antibody Dilution:1:4000Gene Name:MAKSubmitted by:Dr. Crissy Dudgeon, Ph.D., CINJ)

Western Blot (WB) (Lanes:1. 30 ug MiaPaca-2 cell lysate2. 30 ug Panc-1 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-Rabbit HRPSecondary Antibody Dilution:1:4000Gene Name:MAKSubmitted by:Dr. Crissy Dudgeon, Ph.D., CINJ)

Western Blot (WB)

(WB Suggested Anti-MAK Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-MAK Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Hela cell lysate)
Related Product Information for anti-MAK antibody
This is a rabbit polyclonal antibody against MAK. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MAK is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. It is expressed almost exclusively in the testis, primarily in germ cells. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. There is, however, a study of the mouse homolog that has identified high levels of expression in developing sensory epithelia so its function may be more generalized.The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. It is expressed almost exclusively in the testis, primarily in germ cells. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. There is, however, a study of the mouse homolog that has identified high levels of expression in developing sensory epithelia so its function may be more generalized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70kDa
NCBI Official Full Name
serine/threonine-protein kinase MAK isoform 1
NCBI Official Synonym Full Names
male germ cell associated kinase
NCBI Official Symbol
MAK
NCBI Official Synonym Symbols
RP62
NCBI Protein Information
serine/threonine-protein kinase MAK
UniProt Protein Name
Serine/threonine-protein kinase MAK
Protein Family
UniProt Gene Name
MAK
UniProt Entry Name
MAK_HUMAN

NCBI Description

The product of this gene is a serine/threonine protein kinase related to kinases involved in cell cycle regulation. Studies of the mouse and rat homologs have localized the kinase to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired. Mutations in this gene have been associated with ciliary defects resulting in retinitis pigmentosa 62. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

Uniprot Description

MAK: a protein kinase of the RCK family of kinases. It is expressed at high levels in the testis (primarily in germ cells), and in developing sensory epithelia. Localizes to the chromosomes during meiosis in spermatogenesis, specifically to the synaptonemal complex that exists while homologous chromosomes are paired.

Protein type: Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.22; Nuclear receptor co-regulator; Protein kinase, CMGC; CMGC group; RCK family

Chromosomal Location of Human Ortholog: 6p24

Cellular Component: centrosome; photoreceptor outer segment; photoreceptor inner segment; cytoplasm; midbody; nucleus

Molecular Function: protein binding; cyclin-dependent protein kinase activity; transcription coactivator activity; ATP binding; protein kinase activity

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; regulation of cell cycle; multicellular organismal development; protein amino acid autophosphorylation; photoreceptor cell maintenance; spermatogenesis; cell differentiation; protein amino acid phosphorylation

Disease: Retinitis Pigmentosa 62

Research Articles on MAK

Similar Products

Product Notes

The MAK mak (Catalog #AAA3206282) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAK antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MAK can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the MAK mak for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WNTKTGRGQF SGRTYNPTAK NLNIVNRAQP IPSVHGRTDW VAKYGGHR. It is sometimes possible for the material contained within the vial of "MAK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.