Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MTMR1 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

Rabbit MTMR1 Polyclonal Antibody | anti-MTMR1 antibody

MTMR1 antibody - C-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
MTMR1; Polyclonal Antibody; MTMR1 antibody - C-terminal region; anti-MTMR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY
Sequence Length
665
Applicable Applications for anti-MTMR1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MTMR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MTMR1 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-MTMR1 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-MTMR1 antibody
This is a rabbit polyclonal antibody against MTMR1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MTMR1 is a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases.This gene encodes a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases. Alternatively spliced variants have been described but their biological validity has not been determined.
Product Categories/Family for anti-MTMR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
myotubularin-related protein 1 isoform 2
NCBI Official Synonym Full Names
myotubularin related protein 1
NCBI Official Symbol
MTMR1
NCBI Protein Information
myotubularin-related protein 1
UniProt Protein Name
Myotubularin-related protein 1
UniProt Gene Name
MTMR1
UniProt Entry Name
MTMR1_HUMAN

NCBI Description

This gene encodes a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases. Alternatively spliced variants have been described but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

MTMR1: Lipid phosphatase that acts on phosphatidylinositol 3- phosphate and phosphatidylinositol (3,5)-bisphosphate. Belongs to the protein-tyrosine phosphatase family. Non-receptor class myotubularin subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.3.64; Carbohydrate Metabolism - fructose and mannose; Protein phosphatase, tyrosine (non-receptor); Phosphatase, lipid; Motility/polarity/chemotaxis; Cofactor and Vitamin Metabolism - thiamine; Cofactor and Vitamin Metabolism - riboflavin

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: cytoplasm; plasma membrane; cytosol

Molecular Function: phosphatidylinositol-3-phosphatase activity; protein tyrosine phosphatase activity

Biological Process: phospholipid metabolic process; phosphatidylinositol biosynthetic process; phosphoinositide dephosphorylation

Research Articles on MTMR1

Similar Products

Product Notes

The MTMR1 mtmr1 (Catalog #AAA3206218) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MTMR1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MTMR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MTMR1 mtmr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KEDVYTKTIS LWSYINSQLD EFSNPFFVNY ENHVLYPVAS LSHLELWVNY. It is sometimes possible for the material contained within the vial of "MTMR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.